Story cover for Dangly Bells: The Poor But Simple Jester. by callmethedanglyone
Dangly Bells: The Poor But Simple Jester.
callmethedanglyone
  • WpView
    Reads 19
  • WpVote
    Votes 0
  • WpPart
    Parts 1
  • WpHistory
    Time <5 mins
  • WpView
    Reads 19
  • WpVote
    Votes 0
  • WpPart
    Parts 1
  • WpHistory
    Time <5 mins
callmethedanglyone
Ongoing, First published Sep 23, 2016
actionaidsbro-fistcancercripplingdepressioncyka-blyatfeministsfunhip-hophipkidshitlerminecraftletsplaysmorecancerparodyrapromanceswagthemangaweebsyoutubemoney
Have you ever wondered what cancer would look like if it were mostly human? I can give you the answer to this burning question in your soul. Dangly Bells, a violent being that usually makes his refuge in unfunny children, but nobody has seen him in centuries. Most presumed him dead after trying to roast Jesus Christ, after all, he did get struck by holy lightning. Now, a child has been born, but not just any child, a misogynistic Hispanic boy. Will Dangly Bells arise once again? Find out next time on Dragon Ball Z!
All Rights Reserved
actionaidsbro-fistcancercripplingdepressioncyka-blyatfeministsfunhip-hophipkidshitlerminecraftletsplaysmorecancerparodyrapromanceswagthemangaweebsyoutubemoney
Table of contents

1 part

Sign up to add Dangly Bells: The Poor But Simple Jester. to your library and receive updates
or
#109aids
Content Guidelines
You may also like
THAT FIRST BREAK (Broken Redemption Prequel 1) by ArianaClarkAuthor
22 parts Ongoing Mature
Choosing her cost me everything I'd ever loved... including her. I had everything a guy could ask for, a loving family, the perfect small-town life, and a promising future I had worked hard for. It should have been enough. She was off-limits, my parent's best friend's daughter, practically my sister. I fought my feelings, pretending our soul-deep connection didn't exist. When she confessed she felt the same, I pushed her away, believing our friendship mattered more than temporary infatuation. That she agreed should have come as a relief, but it left me with this void I didn't know how to fill. It's what drove me to the bonfire that night. Right there, with our friends as witnesses, I claimed her. Told her I loved her and made her promises I shouldn't have made. Hours later, it all came crashing down in a whirlwind of fire and ashes. That one split-second choice to go after a girl that wasn't meant for me cost me everything I loved. I never should have crossed that line or given in. It's why she'll forever be my greatest love and deepest regret. This tragic story is the beginning of our end...
REVISED:The Boy With A Touch Of Cancer (BxB) by Jeanne_Wolf
32 parts Complete Mature
"Leo pinned me against the wall with his hips. His hands gently gripped my wrists, keeping my arms above my head against the cool brick behind me. His quicksilver eyes were filled with such an intense, carnal desire I couldn't even look into them, so I looked over his shoulder. I saw a few kids from the group standing out by their cars who would easily be able to see what we were doing...or at least what Leo was doing to me. At that moment, my mind started wandering to all the things that I could be doing to him right now...but I stopped that train of thought immediately, as it started heading to all the wrong places... All the dirty places. I glanced back at Leo. His gaze was still as intense as it was before. He smirked at me and said confidently, "You can't ignore me forever, Ethan. You're eventually gonna fall for my charms..." Ethan Carter was focused on 2 things. 1. School (obviously) and 2. Getting over ex (it's proving to be, harder than he thought), but now he has to add dying to that list, and suddenly having feelings for a boy. Leo Malone makes Ethan feel things he's never felt for another guy. Leo's sweet, patient, and understanding...the only problem is, he's a guy. Ethan tries to ignore the fact that his heart flutters every time he sees Leo, or that he can't ever stop thinking about him, but if having cancer has taught him one thing, it's that you have to live in the present, as you may not have a future.
Super Brave Little Firefighter Stuffed animals and BFFs Vs Brain tumor Fire by Autobotpikachu
8 parts Complete
Hot shot is an active and playful child. He lives with his parents Heatwave and Quickshadow. They live in Fort Worth Texas. They live a very happy life there. However soon Hot shot begins to feel unwell. He has a headache, he has nausea with vomiting, he is tired, he is cranky, he is walking funny, his is losing his coordination, he is falling down a lot, he is seeing two of everything, have weird eye movements, has a head tilt and a stiff neck. On the week before his fifth birthday Hot shot has to be taken to Cook Children's hospital. Hot shot has an MRI done and other tests done. Then Hot shot is diagnosed with Medulloblastoma a type of brain tumor that is brain cancer. Hot shot is brave and ready to fight his cancer head on with his stuffed Rhino Roxy who he got as a present. Hot shot makes friends with four other kids his age with the same type of cancer. They decide to fight their cancer together and become the best of friends. They are determined to win too! (Humanized)
A Brave Little Firefighter, A Dragon, and BFFS VS Brain Tumor Fire by Autobotpikachu
13 parts Complete
Hot shot is a playful and active 5 year old. He lives with his dad Heatwave and mom Quickshadow. His father Heatwave is a firefighter, his mother Quickshadow is a stay at home mom. They all live in Fort Worth Texas. Hot shot loves to run, jump, climb and play. Hot shot wants to be a firefighter or a baseball player or a zookeeper who works with rhinos or something else. Hot shot is full of dreams and hopes. Hot shot is a very healthy child too. However in early May Hot shot starts to feel unwell. Hot shot has a headache that won't go away, he is vomiting, he was walking funny, he was having trouble with his eyes, he has a stiff neck and a head tilt. His parents are worried and they take him to his pediatrician. The doctor sends them to Cook Children's for an MRI. There Hot shot is diagnosed with a brain tumor. After a sample of the tumor is biopsied Hot shot is diagnosed with Medulloblastoma a type of brain cancer. Hot shot is brave and ready to face his cancer head on. Hot shot makes friends with four other kids his age with the same type of cancer. They decide to fight their cancer together and become the best of friends. Hot shot is determined to kick cancer's butt. (Humanized)
WHAT THEY SEE by Mya2tact
41 parts Complete Mature
"I got you something." He told her pulling away, while she watched him curiously until he pulled out a pandora bag. Her eyes widened at the necklace with an infinity symbol in crested with small little diamonds. "How you even afford this kari?" She questioned, unable to take her eyes off of it. "Shit, my savings." He rubbed the back of his head that possessed his starter loc twists. "That was so nice of you, you didn't have too." She smiled softly finally looking at him, "Can you put it on me?" He stood behind her and she moved her hair out of the way as he put it around her neck and clipped it back together. Her hand immediately went to it. "I'm never gone take it off." She promised him turning to face him. "I love you kari." "I love you too, hone. Til Infinity." --- When an unfortunate sequence of events suddenly separates two bestfriends, Dakari and Honesty, with no plausible reason, it's shakes up the world of the two inseparable individuals. With no goodbyes shared, Dakari was left feeling alone and heartbroken by the sudden disappearance of the only person outside of family that he cared for deeply. The outside world declared Dakari mad at the world, and he didn't think he could ever get over the missing void created by her absence. When honesty finds herself back where it all began, she discovers the hard way that Dakari no longer wants anything to do with her. The unexpected reunion rekindles unbearable memories of their deep connection and the painful separation that slowly but surely leads them back to each other. It's up to them to pick up the pieces of their broken friendship as they confront their past and face what's in store for their future, whether it's together or apart. They must decide if their love is strong enough to hurdle over the obstacles sent their way from every angle. Is true love worth fighting for no matter how long it takes? Published; Dec 24th, 2023 Finished; July 3rd, 2024
The Good Girl Boxer by maybooks04
49 parts Complete
COMPLETED BUT EDITING ~~~~🌸~~~~ "Look who joined us boys. If it isn't the GG herself." I rolled my eyes and taped my hands as one of the annoying jocks sauntered my way. "What are you doing here GG? Book club is in the other hallway." I heard his little group laugh and I stood up once I was done taping my hands. Standing at my full height I was only up to his nose, but I didn't care, "You know maybe if your egotistical head wasn't shoved so far up your butt, maybe you could actually make some friends who like you." I turned on my heel and walked to an open mat when the jock who I had just insulted, grabbed my shoulder and turned me to face him, "You can not speak to me like that you Good Girl." I was getting so tired of the nick name, "Then fight me and see how much of a 'Good Girl' I really am." ~~~~🌸~~~~ When Daytona Lyn literally runs into Logan Wylde, things kind of start to go down hill from there. She gets threatened, deceived, and it all takes a toll on her for the worst. Someone even makes it their personal goal to see her suffer to the point of no return. Between the lies, deception, hurt, and everything else that could possibly go wrong in her life, will Logan be able to save her, or will she be too far gone? ******************** #58 in Drama- 09/16/18 #45 in Romance- 07/11/19 #31 in Teen Fiction- 04/14/18 #8 in Teen Fiction- 11/28/18 #3 in Drama -07/24/19 #2 in Humor- 10/3/18 Copyright @maybooks04
ORIGINAL:The Boy With A Touch Of Cancer(BxB) by Jeanne_Wolf
32 parts Complete Mature
"Leo pinned me against the wall with his hips; his hands gently gripping my wrists, keeping my arms above my head against the cool brick behind me. His beautiful, hazy blue eyes -that had turned straight quicksilver, again- were filled with such an intense, carnal desire I couldn't even look into them, so I looked over his shoulder. I saw a small group of kids from the group standing out by their cars who would easily be able to see what we were doing...or at least what Leo was doing to me. At that moment, my mind started wandering to all the things that I could be doing to him right now...but I stopped that train of thought, immediately, as it started heading to all the wrong places... All the dirty places... All of those places involving a very hard part of my body... I glanced back at Leo; his gaze was still as intense as it was before (unfortunately). He smirked at me and said confidently, "You can't ignore me forever, Ethan. You're eventually gonna fall for my charms..." Ethan Carter was focused on 2 things. 1. School (obviously) and 2. Getting over ex (it's proving to be, harder than he thought), but now he has to add dying to that list, and suddenly having feelings for a boy (which has happened once before, but Ethan tries to forget it). Leo Malone makes Ethan feel things he's never felt for another guy. Leo's sweet, patient, and understanding, the only problem is, he's a guy. Ethan tries to ignore the fact that his heart flutters every time he sees Leo, or that he can't ever stop thinking about him; but if having cancer has taught him one thing, it's that, "You have to live in the present, as you may not have a future."
Our Brave Little Firefighter Hot shot and BFFS Vs Brain tumor Fire by Autobotpikachu
17 parts Complete
Heatwave and Quickshadow are a happily married couple. They live in Fort Worth Texas together. Heatwave is Firefighter and Quickshadow is a pediatric oncologist who works at Cook Children's hospital. They are very happy. Soon the adopt a baby boy they name Hot shot. They are so happy to have him and love him very much. They tell Hot shot from the beginning he is adopted. Hot shot accepts that. Hot shot even gets things from his birth mother. Hot shot is growing into a very happy and healthy boy. Hot shot is now five years old. In June Hot shot begins to feel unwell. He has bad headache, he is vomiting, he is tired, he is walking funny, he is falling down a lot, and he has a head tilt. His parents take him to see his pediatrician Dr. Erret. Dr. Erret sends Hot shot to Cook Children's hospital to get an MRI. The MRI reveals that Hot shot has a brain tumor. Hot shot's tumor is biopsied and they do tests on the sample. Then Hot shot is diagnosed with Medulloblastoma a type of brain cancer. Hot shot is very brave and ready to fight his cancer. Hot shot makes friends with four other children his age who have the same type of cancer. They become the best of friends and decide to fight their cancer together. Hot shot is determined to kick cancer's butt! (Humanized)
Our Brave Little Firefighter Hot shot and BFFS VS Brain Tumor Fire by Autobotpikachu
14 parts Complete
Heatwave and Quickshadow are a happily married couple and they live in Fort Worth Texas. Heatwave is a firefighter and Quickshadow is a pediatric oncologist who works at Cook Children's hospital. They are happy with their life and soon they have a son. They name him Hot shot. They love Hot shot very much. Hot shot is growing into a very happy and active child. He loves to run, jump, climb and play. He is now five years old. Hot shot soon begins to feel unwell in May. Hot shot is wondering why he is feeling so bad. He has a headache that won't go away, he is vomiting, he is tired, he is walking funny, he is loosing coordination, he is falling down a lot, and he has a head tilt. He is feeling so bad one night his parents rush him to the ER of Cook Children's hospital. There Hot shot is admitted for being sick and was in a lot of pain. A hospitalist who is caring for Hot shot is worried and decides a scan is needed. The next morning she sends Hot shot to get an MRI. Then Hot shot is discovered to have a brain tumor. The brain tumor gets a biopsy sample. Then Hot shot is diagnosed with Medulloblastoma a type of brain cancer. Hot shot is ready to be brave and fight his cancer. He makes friends with seven other kids in the hospital with the same type of cancer. They become the best of friends and decide to fight their cancer together. Hot shot is determined to kick cancer's butt. (Humanized)
You may also like
Slide 1 of 9
THAT FIRST BREAK (Broken Redemption Prequel 1) cover
REVISED:The Boy With A Touch Of Cancer (BxB) cover
Super Brave Little Firefighter Stuffed animals and BFFs Vs Brain tumor Fire cover
A Brave Little Firefighter, A Dragon, and BFFS VS Brain Tumor Fire cover
WHAT THEY SEE cover
The Good Girl Boxer cover
ORIGINAL:The Boy With A Touch Of Cancer(BxB) cover
Our Brave Little Firefighter Hot shot and BFFS Vs Brain tumor Fire cover
Our Brave Little Firefighter Hot shot and BFFS VS Brain Tumor Fire cover

THAT FIRST BREAK (Broken Redemption Prequel 1)

22 parts Ongoing Mature

Choosing her cost me everything I'd ever loved... including her. I had everything a guy could ask for, a loving family, the perfect small-town life, and a promising future I had worked hard for. It should have been enough. She was off-limits, my parent's best friend's daughter, practically my sister. I fought my feelings, pretending our soul-deep connection didn't exist. When she confessed she felt the same, I pushed her away, believing our friendship mattered more than temporary infatuation. That she agreed should have come as a relief, but it left me with this void I didn't know how to fill. It's what drove me to the bonfire that night. Right there, with our friends as witnesses, I claimed her. Told her I loved her and made her promises I shouldn't have made. Hours later, it all came crashing down in a whirlwind of fire and ashes. That one split-second choice to go after a girl that wasn't meant for me cost me everything I loved. I never should have crossed that line or given in. It's why she'll forever be my greatest love and deepest regret. This tragic story is the beginning of our end...

More details