Son Of Luck (Naruto x Percy Jackson crossover)
gregorybryce9
  • Reads 9,439
  • Votes 153
  • Parts 3
  • Time 44m
  • Reads 9,439
  • Votes 153
  • Parts 3
  • Time 44m
gregorybryce9
Ongoing, First published Sep 23, 2016
annabethcrossoverfamilygardnergreekkatielastluckmanhattanmythsnamikazenarutoolympianspercysecretstyche
The Battle of Manhattan looms in the distance and with the camp's hero, Percy Jackson off in the mortal world, camp morale is low. But in comes a new golden boy. Naruto Namikaze is brought into the world of demigods by a freak accident and discovers he is more than he seems. A new hero has hit the scene and is reeking havoc on their enemies. But will it all go over well? Or is the camp not large even for two child of prophecies? 

Features Chakraless!Naruto and Demigod!Naruto.


Story can be found on Fanfiction.net under the same username.
Public Domain
annabethcrossoverfamilygardnergreekkatielastluckmanhattanmythsnamikazenarutoolympianspercysecretstyche
Table of contents

3 parts

Sign up to add Son Of Luck (Naruto x Percy Jackson crossover) to your library and receive updates
or
#127last
Content Guidelines
You may also like
Changing The Future by Im_a_nerd3
16 parts Ongoing
The Potters have a set of twins, a boy, the son of James, and a daughter that's not James's but Poseidon's. Poseidon possessed James when they were conceived. the story takes place in the original harry potter time line. Harry Potter and Percy Jackson are the same person. After Voldemort attacks the Potters, their son Jamie is hailed as the boy who lived when actually it's Poseidon's daughter, Andromeda, who goes by Andi. The Potters neglected her for the next year when Poseidon steps in and takes her. he takes her to a Witch named Sally Jackson. Shortly after the goddess Artemis was made an Olympian, a prophecy was given that foretold of a Demigod daughter of Poseidon, and that they would be soulmates. Artemis still makes her vow to remain a virgin, but with the loop whole that she would be able to break the vow when she met her soulmate. Four thousand years later, Artemis had almost lost hope of ever meeting her. When the big three swore on the Styx to never have kids again, she loses all hope. That is until about 35 years later when Andromeda was born. The Lightning thief and Sea of monsters pretty much stay the same with some minor tweaks. it's when we get to the Titans curse that the big changes happen in the timeline. I don't know how to incorporate any of the Harry Potter books just yet, only because Andi never went to Hogwarts. All rights belong to Rick Riordan and J.K. Rowling. I do not own either series
[DISCONTINUED] [Adopted by Silen5t] A Greek Ninja by Timeless_95
50 parts Complete
Percy Jackson, more commonly known as Haru Namikaze among the shinobi, is a ninja blessed by Greek gods. His mother, Sally Jackson, AKA Fuyura Uchiha, was born of the forbidden love between an Uchiha and a Hyuga, they were exiled to America where they adopted new names. His father, Paul Blofis, AKA Akira Namikaze, is the brother of Minato Namikaze, their clan, the Namikaze, are blessed by Artemis, because their clan is one of the only clans that treats women how Artemis likes it. Haru was also directly blessed by Poseidon because his mother was one of his favourite mortals. Now we watch as Haru, a ninja prodigy, joins Naruto and his friends on their long journey ahead. Haru joins Naruto's cell and every other village in the country now consists of all 4-men cells. Haru, being the descendant of both an Uchiha and a Hyuga, his right eye is a Sharingan, and his left eye is a Byakugan. His mother was killed by a rogue, Gabriel Ugliano, his father was killed trying to protect her, when Percy found out, he became enraged and unlocked his Sharingan, he was so mad that his Byakugan also developed, using a ninja art he has never really closely studied, he summoned several shadow clones and killed Gabe. Percy was trained by his parents to use twin katanas, but he had never used them in a real battle, he found his twin katanas with a note from his mother, telling him to go to Japan and seek out his father, Minato Namikaze. He found a strip of cloth and tied it over his eyes so that people wouldn't question his eyes. Percy never goes to Camp Half-Blood, and he left for Japan when he was six years old. Graduated ninja school when he was 8, and stayed for four years at the Hokage's command to watch over the students, he joined Naruto's cell after seeing how dysfunctional it is. Wanna find out more? Click that read button. Disclaimer: I am not Rick Riordan, nor am I Masashi Kishimoto, I do not own Percy Jackson, Naruto or the images, I only own the plot.
Dreams Of Madness by Elentiya2007
35 parts Complete
| A Percy Jackson Fanfic | 4 Camp Half-blood demigods are given a quest they think is not of much importance, so the less popular demigods are sent. But as the quest unfolds and secrets are revealed this quest is as important as any other. As the mortals and demigods decsent into madness from the dreams sent, they will need help. When they clash into 4 Camp Jupiter demigods, they are thrown into a web of danger, gods, dreams, and, feelings. But only all of them together can complete the quest. Or they would fail. *This story is written with @Willow0708. Follow her for more content:)*
Alliance{Discontinued} by indecisivemango
8 parts Complete
Percy, Annabeth, Nico, Will, and Leo get called away from Camp Half-Blood, when they were settling down after the Giant War, to go on an urgent mission, help the wizards with their war, which they will lose without help. Harry's sixth year of Hogwarts couldn't have been better. Sirius was okay, and everyone believed him. But his arrogant and jealous side of him shows when five new suspicious kids come from America. Patience will be tested, lines will be drawn. Will the golden trio ruin their chances of winning the war? Contains golden trio bashing Ships are Percabeth, Solangelo, Nuna, and Sirius/Remus. What happens if Sirius didn't die? Leo never went to get Calypso? Or Harry, Ron, and Hermione let their arrogance show? Read and find out!
The Path Of Glory (Annabeth Chase x Male Reader) by Antovirlou
103 parts Complete
"You will be glorious. You will be my glory." Y/N's life was quiet before that day. What day? The day a giant snake tried to kill him. Then it became really weird for sure. First, a lightning bolt was stolen. How is that even a thing? Y/N didn't know either yet he found himself on a quest to turn it up. After that, a tree went sick, and more than from a cold. Y/N couldn't even enjoy the winter holidays that followed since a goddess found herself in danger. Then he fell into a labyrinth. Finally, he fought in the infamous battle of Manhattan. Oh, and did I say this is only the first act of his story? You think I'm talking rubbish, don't you? Well, come on, follow me on the story of Y/N! Discover what he did and what he got out of it. Percy Jackson doesn't belong to me, this story has been written by Rick Riordan and is his. I use it only to create my own. #1 in reader (22/01/2022) #1 in xmalereader (18/02/2022) #1 in thelightningthief (12/03/2022) #1 in quest (04/04/2022) (25/05/2023) (27/08/2023) (03/08/2024) (01/09/2024) #1 in annabethchase (03/05/2022) (23/08/2022) #1 in annabethxreader (31/07/2022) (25/10/2022) (04/09/2023) (01/09/2024) #1 in olympians (04/12/2022) Thank you!
Demigods at Hogwarts by Hannah-oftheInternet
37 parts Complete
FAIR WARNING: THIS STORY IS REALLY SHITTY, OLD, AND DESTINED TO BE INCOMPLETE FOR ETERNITY. HAVING READ THIS WARNING, DO NOT COMMENT/SEND ME MESSAGES ASKING FOR UPDATES. THANK YOU. THIS HAS BEEN A PSA. What happens when demigods go to Hogwarts? Chaos, secrets, and lies, that's what! The Seven, Nico, and Reyna are part of an exchange program planned by Chiron. Can they hide all their secrets before it's too late? The Golden Trio, Ginny, Neville, and Luna are assigned to guide the Americans around. Can they risk having the exchange students around them? This is a story about how two very different groups of people set aside their differences to defeat a greater enemy- for neither can win while the other is defeated.
Expect the Unexpected (A Percy Jackson/Chaos fanfiction) by Blackfur003
38 parts Complete
*COMPLETED* Percy never expected to die the way he did. He never expected to magically come back to life. He never expected to be in an army. And he never expected to fight another war. But sometimes, you need to expect the unexpected. When Percy Jackson, Son of Poseidon dies, things take an unexpected twist. He meets yet another immortal and BOOM he's alive again. When the demigods need help in the biggest war of all, it's time to fight again (yippee)! Old enemies arise and new friendships are made, the demigods of Camp Half-Blood and Camp Jupiter are back again! *SET AFTER BLOOD OF OLYMPUS, APOLLO IS A GOD, LEO STAYED DEAD, MAY CONTAIN SPOILERS FOR HEROES OF OLYMPUS* *I do not own the Percy Jackson characters, they belong to Rick Riordan. The only thing I own is my OC(s)*
[Under Re-Write] Naruto Uzumaki: Lighting Dragon Slayer by armoredlord1115
8 parts Complete Mature
Naruto Uzumaki secretly Naruto Namikaze had been unfortunate enough to be born on the day of the Kyuubi attack as his father the Yondaime Hokage Minato Namikaze had no choice but to seal the Nine-tails inside his own child unaware of the horror he had subjected his son but despite the curse of being a Jinchuriki it was also a blessing in disguise as he met people he knew that he could rely on in the times of his needs and they would accept him no matter what he is. Naruto Namikaze will show the world what happens when he is challenged and with the Thunder Legion and The Strauss siblings nothing could stand in there way.
Brothers Reunited by GeekyDarkPoet
16 parts Complete
Disclaimer: I do not own Marvel or anything Percy Jackson or Heroes of Olympus related. I only own the storyline. Nico di Angelo has a mortal half brother he never told anyone about. When Nico gets injured and found by the Avengers, how will he react after finding out his brother is still alive and surprisingly young? Meanwhile, the Death Gods conference approaches. Nico must decide whether to embrace his role as Hades' heir or place his mortal and demigod family first. Cover art credit: Viria I keep language Steve appropriate, and I try to use correct grammar. Best rankings: #1 in nicodiangelo #1 in willsolace #1 in solangelo #5 i n steverogers #32 in percyjackson #41 in crossover
Percy Jackson: Grandson Of Voldemort by Athenasravenclawgurl
28 parts Ongoing Mature
SPOILERS FOR DEATHLY HALLOWS AND BOO Percy jackson had just been done with the Giant war , yet the fates cant let him be. He gets attacked by people in black robes claiming to work for his grandfather. his first thought went to kronos and he went to camp to warn them, but before he could say anything a new prophecy sent him to england. ~~~~~~ Status: Ongoing All rights to Uncle Rick and the transphobic prick. #1 in percygoestohogwarts #1 in demigods #2 in harryandpercy #3 in persassy
The Magical Quest by Demigod_Assasin
25 parts Ongoing
A PJO/Harry Potter Crossover book It's been years since the events of trials of Apollo. Nico Di Angelo has been gone on a quest to a wizarding school for almost an year when all of a sudden all contact from him dissapears. When no one is able to contact him, Percy is asked by the God of Underworld himself to investigate the whereabouts of his missing son. Joined by his girlfriend Annabeth and Nico's concerned boyfriend, this new trio must find the missing Demigod.
The Demigod King; Book 2 by 5_m0re_minutes
34 parts Complete Mature
Percy, Annabeth, and Nico just saved the Wizarding World from Voldemort. But that victory came at a price: Percy. Bellatrix Lestrange has been holding Percy hostage and torturing him as leverage for the next battle. Voldemort is dead and gone, but the ideas he preached are not. It's 10 months later and Harry's sixth year at Hogwarts is about to start, but Percy is still being held captive. Demigod reinforcements have arrived, but will it be enough to save Percy? Will it be enough to defeat Bellatrix and the army she's amassing, including an Ancient Greek power?
Project Goddess || Percy Jackson x Reader by WritingGirl46
24 parts Complete
One day on Olympus, the gods agreed to test their powers and see what they could do. Which resulted in them creating a whole new goddess named (Y/n). (Y/n) must train and learn how to survive as an immortal goddess. But when the Fates arrive and tell the gods they have altered time in an negative way when creating (Y/n), they must send her to Camp Half Blood and live a life as a demigod without anything knowing she is a goddess. At Camp Half Blood she meets a certain demigod named Percy Jackson. [A/N] I wrote this when I was twelve, so I deeply apologize uhh this whole story is a mess [percy jackson x f!reader]
Meet Percabeth (+Oneshots) by AnnabethDare
34 parts Ongoing
Mortals and demigods alike meet our favorite demigods and couples! There may be stories with multiple parts, some where the demigods are gods or the new Olympians, they might be famous in the mortal world, they may be adults and more! Also, now that I notice, this story is more of a 'one shots book', than a 'meet Percabeth book'. But, details, details, and honestly, I don't care. Hope you enjoy! Rick Riordan owns PJO, I only own my OC's. Most of the ideas/characters are mine, some may be from other people's suggestions. //Most Impressive Ranking(s)// #3 in Frazel as of 18 June 2024
Myth and magic by dutch_daydreamer
29 parts Complete
When Sally Jackson gets attacked, Percy Jackson finds out about a secret Sally had been keeping about her side of the family. He finds out his grandfather is looking for him. Old friends of Sally take Percy into a world filled with magic. He joins Harry Potter and his friends in their fifth year at Hogwarts. But where Percy goes, trouble follows. Which basically means: monsters. Percy prommised to help and aid the wizards in their battle against Voldemort. But how is one demigod going to make the difference.. ------------- I don't own the characters of the story, they belong to Rick Riordan and JK Rowling. The cover isn't mine as well. So credits to them. The plot does belong to me. -------------- Hope you enjoy the story ! Love every single one of you 💙 -L #1 Percyjackson |6-2-2021| #1 Hogwarts | 14-6-2021|
The Demi-God shinobi. by meliodasshinigumi
13 parts Complete Mature
What if the battle at the valley of the end when Sasuke left the village ended differently. What if instead of Kakashi finding Naruto, Minato did? What if Minato wasn't who he said he was but in fact a god. Naruto died that day, but centuries later he wakes up in a new era. How will the young shinobi survive in a era more dangerous than his previous one? Mature later on.
Nico, Voldemort's Older Brother (Being Rewritten) by _Jewelmist_
35 parts Complete
(The rewritten version is up) What if Nico had a younger brother? One that wants to take over the world? Not just the world, but wants to achieve immortality? Nico wanted a quiet life-as quiet as a demigod can get. Instead, he gets kidnapped by the Order of the Phoenix and is judged by the actions of his half brother, Tom Riddle-or as he is widely known, Voldemort. When he gets to Hogwarts, it's the Triwizard Tournament, will he survive? Or will he fall to his brother and the Death Eaters? Is Albus Dumbledore who he thinks he is? Voldemort, evil villain or innocent under a evil spell? Set after The Trials of Apollo and during The Goblet of Fire. By _Jewelmist_ and ChildOfFantasy. I DO NOT OWN HARRY POTTER OR PERCY JACKSON, THEY BELONG TO J.K. ROWLING AND RICK RIORDAN
The Demigod Invasion (Percy Jackson and Harry Potter Crossover) by FluffyeEyeball
24 parts Complete
It was a month after the Second Titan War, and Percy, Nico, and Thalia are reluctantly being sent to Hogwarts School of Witchcraft and Wizardry on a quest. But, Percy would much rather spend it with his Wise Girl. Their job: protect Harry Potter. A seemingly easy quest, until Harry's name ends up in the Tri-Wizard Tournament. Now, they find themselves getting grey hairs, and losing sleep, as they try to keep us with the Wizarding World. In this crossover, they meet Ron, Harry, and Hermione as they try to navigate their fourth year and the Tri-Wizard Tournament. But what evil plans do they discover one Goddess has in mind? Read and find out.
The Lost Soul : Untold Story of Percy Jackson by Silver_The_Fourth
35 parts Complete
Chronicles Of Íroas - A Percy Jackson And Harry Potter Crossover : Book 1 In the last battle of the Giant War, a hero selflessly sacrificed himself to save others. But what would possibly happen if that hero's soul is transmigrated to another body? And the world he once lived in is now unknown to him. Ended up in a domain of a Goddess where excellence in sorcery defines the greatness of an individual. Follow Percy Jackson as he explores his new gained life, far from the world of myths and monsters; and unravel the unspoken truths and the fragments of the past, desperately fighting to be freed behind the walls of his obscured mind.
Percy Jackson meets Naruto Uzumaki (book 1) by SallieSteinberg
22 parts Complete Mature
I don't own Percy Jackson & The Olympians Rick Riordan does and I do not own Naruto Masashi Kishimoto does. But I do own my own Characters. This Stoy is about Percy Jackson and Naruto Uzumaki. Percy and Annabeth are not together. Naruto Uzumaki is being treating bad so the gods sent Percy Jackson to help and he get back he will be turned into a god himself if Naruto come the him will he be turned into a god too? What's with Sally and Poseidon/Neptune god of the sea and what the big Secret? Where Paul Blofis? will Naruto sill get with Hinata Hyūga will they sill have 2 kids or more. Percy Jackson get with Anko Mitarashi or someone else if someone in mind please tell me. it set after Gaia But after the death 3rd Hokage but before the 4th Great Ninja War. and other might show up.I'm not set on pairing so any idea would help I hope you enjoy it!!!!!
You may also like
Slide 1 of 20
Changing The Future cover
[DISCONTINUED] [Adopted by Silen5t] A Greek Ninja cover
Dreams Of Madness cover
Alliance{Discontinued} cover
The Path Of Glory (Annabeth Chase x Male Reader) cover
Demigods at Hogwarts cover
Expect the Unexpected (A Percy Jackson/Chaos fanfiction) cover
[Under Re-Write] Naruto Uzumaki: Lighting Dragon Slayer cover
Brothers Reunited cover
Percy Jackson: Grandson Of Voldemort cover
The Magical Quest cover
The Demigod King; Book 2 cover
Project Goddess || Percy Jackson x Reader cover
Meet Percabeth (+Oneshots) cover
Myth and magic cover
The Demi-God shinobi. cover
Nico, Voldemort's Older Brother (Being Rewritten) cover
The Demigod Invasion (Percy Jackson and Harry Potter Crossover) cover
The Lost Soul : Untold Story of Percy Jackson cover
Percy Jackson meets Naruto Uzumaki (book 1) cover

Changing The Future

16 parts Ongoing

The Potters have a set of twins, a boy, the son of James, and a daughter that's not James's but Poseidon's. Poseidon possessed James when they were conceived. the story takes place in the original harry potter time line. Harry Potter and Percy Jackson are the same person. After Voldemort attacks the Potters, their son Jamie is hailed as the boy who lived when actually it's Poseidon's daughter, Andromeda, who goes by Andi. The Potters neglected her for the next year when Poseidon steps in and takes her. he takes her to a Witch named Sally Jackson. Shortly after the goddess Artemis was made an Olympian, a prophecy was given that foretold of a Demigod daughter of Poseidon, and that they would be soulmates. Artemis still makes her vow to remain a virgin, but with the loop whole that she would be able to break the vow when she met her soulmate. Four thousand years later, Artemis had almost lost hope of ever meeting her. When the big three swore on the Styx to never have kids again, she loses all hope. That is until about 35 years later when Andromeda was born. The Lightning thief and Sea of monsters pretty much stay the same with some minor tweaks. it's when we get to the Titans curse that the big changes happen in the timeline. I don't know how to incorporate any of the Harry Potter books just yet, only because Andi never went to Hogwarts. All rights belong to Rick Riordan and J.K. Rowling. I do not own either series

More details