Story cover for The Man In Green by Moeymoosa
The Man In Green
Moeymoosa
  • WpView
    Reads 1,557
  • WpVote
    Votes 78
  • WpPart
    Parts 23
  • WpHistory
    Time 1h 18m
  • WpView
    Reads 1,557
  • WpVote
    Votes 78
  • WpPart
    Parts 23
  • WpHistory
    Time 1h 18m
Moeymoosa
Complete, First published Nov 28, 2016
Mature
aquedevidaascendedbootstrepparadoxgrandfatherparadoxgreenlightningjinkindmankindmysterypowerpredestinationparadoxscifitemporaltravelthefountainofyouththemaningreenthesphereoftimetimekeepertimetravelwhitetimestonewritteninaction
it was a gloomy and moonlight night, the stars twinkled and the locals of a kingdom near a saharan dessert mingled in the markets

when suddenly lightning struck...

but not just any lightning

green lightning

an apperant visual of a powerful being

green sparks of energy crackled all around the man and women present 

he stood before a young boy

and with his index finger pointed to his forehead

the young man in an after shockwave of green energy began to desiccate in to dust and this powerful being of Green disappeared before the boy was even completely destroyed in to nothingness

none have seen his face

some regarded him as an all powerful tyrant

and powerful he was



He is known as

THE MAN IN GREEN

and this is his Legend



A story inspired by true events
All Rights Reserved
aquedevidaascendedbootstrepparadoxgrandfatherparadoxgreenlightningjinkindmankindmysterypowerpredestinationparadoxscifitemporaltravelthefountainofyouththemaningreenthesphereoftimetimekeepertimetravelwhitetimestonewritteninaction
Table of contents

23 parts

Sign up to add The Man In Green to your library and receive updates
or
Content Guidelines
You may also like
Is it too late to say Sorry? by iambellissima_nishaz
38 parts Complete Mature
"The fuck you are leaving me." His roar cracked through the hall like lightning. Ara didn't blink. She stood there, calm as death, done to her core. No tears. No tremble. Just a weary exhale as she turned her back on him - the one thing he never thought she'd do. Before she could take a step, his hand shot out, gripping her arm like he was holding on to life itself. "Where are you going, Ara!" His command shook the pack. But she wasn't his to command. Not anymore. Ara ripped her arm free with a force that made even his wolf recoil. "Don't. Touch. Me." Her aura slammed into him, cold and merciless. "You think I'll stand here and watch you mate and breed her?" she hissed, every word a dagger. His throat bobbed. "She meant nothing." She laughed - sharp, broken, brutal. "Yeah? That's why you were fucking her in your office? Couldn't even hide the scent of your betrayal." "Ara, it was a mistake-" She stepped closer, eyes blazing. "Your mistakes come in episodes, Alpha. Season one, season two, season three. You don't make mistakes. You make choices." He swallowed hard. "I don't need her. I need you." "Lies," she spat. "Every damn sentence you breathe is a lie. I can't even look at you without feeling sick." He flinched like her words physically hit him. "That female behind you?" she pointed, not bothering to glance. "Perfect for you. Go mark her. Breed her. Hell, fuck her for all I care." Her voice cracked - but she kept going, blade steady even when bleeding. "I don't need you. Not anymore." His knees crashed to the floor. The mighty Alpha. On the ground. For her. "Ara... I'm sorry. I'm really fucking sorry." His voice broke like he finally understood what loss tasted like. She stared at him with a sad, devastating smile. "Isn't it too late for that, Mate?" One tear escaped - and she crushed it away with her thumb. Then she turned. Walked. Didn't look back. But he didn't chase her. Because he knew. He didn't just lose her. He wrecked her.
Beyond the Deep Water by IvetteMartinez01
64 parts Complete
CLOSE YOUR EYES AND IMAGINE THIS WORLD. Gods are created by a mighty force, a force to balance the universe, every galaxy, world, and life. **** Camille tastes the blood on her lips. She's nauseous and weak; still, she forces her brain to stay awake. Ignoring the pain of reopening old injuries. There are more bruises she can't hide, more pain to bear, but she's finally tired to do it in silence. She wipes the humiliating tears off her face. "Don't you dare touch me again." she defies the monster. "I don't even think God is on your side," he says with a reeking smell of alcohol. At the same time, a loud thunder with the brightest lightning illuminates the sky, the rain pours heavily A tall man elegantly walks forward, evidently upset he glances at the girl with the corner of his beautiful crystal blue eyes, tearing apart the man who has dared to put his hands on the girl he's been trying to protect. "A leech like you would never understand the depths of my trust for this girl." The God of Water stands behind her, like a bodyguard. "Giving up has never been an option for you, perhaps taking the garbage out of your way can help you find your freedom." The mysterious man says. Just as he finishes his sentence, a bolt of lightning strikes loudly in the sky. He turns to face the monster as he freezes in shock, He knows, this time he won't be forgiven.
The Rainbow in Darkness by Vibgyor_roygbiv
20 parts Ongoing
Wake up Rose....it already 7...you will get late for school. Just 5 more minutes mom....No dear...sun is already up..get up now....aahhhh.. why god made sun it disturbs my sleep daily..her mom laughs and said,"so that you can go to school and learn new things". Rose gets ready for school and says byee to her mom. Chrrrr.....bus stops...she hops on bus but as usual nobody wants to sit with her....One of the girl staring at her said, "here comes the murderer". WHY THE GIRL CALLED HER MURDERER? HEY GUYSS!!! This is a story about a little girl Rose who gains some magical power with time. She lives with her mother in a city of Alaska. Her mother is her only family after she lost her father. Rose is accused by people for killing her own father whose death is still a mystery. Hope you people will enjoy this story....
The Forest of Lights by Purplestar222
16 parts Complete Mature
Long ago, in a kingdom ruled by silence, two princesses dared to speak. Thana and Khalida were sisters bound by blood but divided by destiny. Together they formed the Guerrillas, a secret band of warrior women fighting for justice in a land that denied them power. But when one sister dares to enter the forbidden heart of their realm-the Forest of Lights, a place of both refuge and fear-a single prophecy brings secrets to light and fractures the bond they believed was unbreakable. In a world where light can deceive and darkness can guide, only the truth within their shattered hearts can save what remains. ~~ The story is finally complete! I'd appreciate your reads so much. ❤ The second book of the series is a work in progress (but may never be finished due to my co-writer disappearing) Note: no, this book has nothing to do with The Bringer of Light, the titles are accidentally similar. I'll try not to put "light" in my next book title lol TRIGGER WARNING: suicide, violence, mental health issues
Never Trust Others Except Yourself by Niandyartic
18 parts Complete
Cale henituse did 'not' survived after using instant. Time is morphed and crumbled after Cale used the said power, to prevent the chaos erupting, the GoD decided to contain the source of the problem (Cale Henituse) in an empty space, where any living beings could not interfere nor touch the young master until the problem could be fixed. While the sudden disappearance of the young master happened, the bear king Sayeru realized that his power has been significantly weakened to the point that he could not even use them normally anymore. The same goes to the White Star, Alberu, Choi Han, and many others who had tremendous powers, on the day where Cale Henituse dissapeared, the eastern and western continents power suddenly.. Weakened. All of the people, strong, weak, or neither, are equal in strenght. Those who are sick are healed in such a short time, and they who were fighting had their weapons dissapear as their hurting body healed in an instant. It seems like the whole continent is on a 'Peace mode' that means that they could not go to war with the sudden condition. the hero and the villain decided to hold a meeting to find the cause of this sudden incident... "Wait, Where is Cale Henituse? " - Trying to escape the white prison, he used his ancient power, the answer of the action is that he was pulled by a mysterious gravity.. Cale was transported to a different dimension, where now he appeared in a forest..with the remains of a burnt village, 2 years ago. -Excuse me, hello! I am Asycky, you can not detect me, it is because I am an ancient power. -..huh? What? So that means- -Shoot! He's going to explode! -ah! Wait, I can explain! The sudden appearing ancient power, Asycky stopped them before causing any more screaming. -My ability can neutralize ones body and change them to the previous condition, it is passive so you guys shouldn't worry. Cale finds himself in the past...
The Weird Insights of a Scobberlotcher by Jimpatton1
48 parts Complete Mature
Seeing the light? Sounds alright. Scales falling from the eyes and all that. A little visit from a revelation. But sometimes the light of a revelation doesn't live up to its advance billing. Sometimes it's not an epiphany at all. The bright burst of an unexpected truth. No, sometimes it's just depressing. Really depressing. And persistent. Especially when the light just keeps flashing on and off. A red light. In a really weird place. "At first I didn't know what to think or do that involved being rational. I did have two distinct, initial emotional reactions, though. First, I was glad I was alone. Second, this seemed a frightening confirmation that I actually had gone mad." This is the story of a man who makes a shocking discovery. He's been afflicted by a very modern disease with no known cure. Until a fortuneteller comes along and changes his mind. Literally. With a large, heavy object . Full of cigarette butts.
Awakening by Otterpop543
26 parts Complete
A small and quiet Utah town is full of life. Friendly neighbors. Beautiful scenery. Friends and family that stand by you no matter what. And the light of faith being their guide and protection. Also hostile shadowy creatures, a town-wide epidemic, an unexpected famine, and unrest between even the closest of friends. And standing in the middle of it all is an ordinary young man with the remarkable, and secret, ability to see spirits and specters. Or at least, that's what he thought. Turns out he's the most unordinary being there, and with his town falling into disarray, all he has are his abilities and a mysterious weapon only he can wield. NOTE: My work is NOT permitted for use in AI-generated programs of any kind.
THE FOUR RACES. The Autumn-The Spring. by nusnus4
1 part Complete
I'm Arais, an undergraduate at University in The Autumn and I'm a Grey. One night I remained in the University Library late into the night while restoring a map, and as I was tidying up I heard a noise coming from a large golden door, behind which rests the greatest relic of all time. My curiosity got the better of me and as I investigated I was shocked to catch sight of a man from the Golden Race! I couldn't believe my eyes! My world is divided into Four Seasons each supporting a different race. Given the differences between our peoples, no race can survive outside their normal domain for long. The Golden man I saw in the library had stolen the relic. But why? Why is it so important that the man risked his life to take it? I saw the thief, I witnessed the theft, so I'm involved in this. Deeper than you can imagine. Do you want to join me to find out more?
Blood and Thunder by KyleWilliamUrban
35 parts Complete Mature
You've just woken in the woods, away from everything you know. You're dazed and confused, unable to comprehend what's just happened. As you are coming to, images flash before your eyes of the last few days. Your parents were taken by the police, you were forced to run, to leave everything behind, to save yourself and your sister. But she isn't here. You panic and look around, you stop. You remember. She too was taken, you are alone. For now. This is what happened to Alexander, his life has just been turned upside down. The year is 2415, the world has both evolved and devolved. It isn't how people imagined. Flying cars, robots in every house, telekinetic pencils. No, they are only in comic books. Self driving cars. No robots in houses, but workhouses instead. Telekinetic pencils... that's possible, if you are gifted with the power of telekinesis. There are dark truths hidden behind closed doors, that only few know. Truths that if they got out, would bring the downfall of the government. A government that has been deceiving people for generations. But they haven't been as careful as they thought, because 100 years ago, one guy found out their secrets. 100 years ago, one guy started the rebellion that would bring about the end. From burning books, rewriting history and breaking human rights, this government will stop at nothing to make it seem that they are doing good. But people have had enough, the secret came out before. It's only a matter of time until it happens again. This time by a group of people that no one expected. Together they work to find out the truth, but things have gotten worse over the last century and this may not only bring around the downfall of the government. Armed only the powers they were born with, the group do everything they can to discover the truth, the whole truth and nothing but the truth. But many have tried and failed, do they really stand a chance? Alexander doesn't think so, but his main concern is finding his sister, Rosia.
You may also like
Slide 1 of 9
Is it too late to say Sorry? cover
Beyond the Deep Water cover
The Rainbow in Darkness cover
The Forest of Lights cover
Never Trust Others Except Yourself cover
The Weird Insights of a Scobberlotcher cover
Awakening cover
THE FOUR RACES. The Autumn-The Spring. cover
Blood and Thunder cover

Is it too late to say Sorry?

38 parts Complete Mature

"The fuck you are leaving me." His roar cracked through the hall like lightning. Ara didn't blink. She stood there, calm as death, done to her core. No tears. No tremble. Just a weary exhale as she turned her back on him - the one thing he never thought she'd do. Before she could take a step, his hand shot out, gripping her arm like he was holding on to life itself. "Where are you going, Ara!" His command shook the pack. But she wasn't his to command. Not anymore. Ara ripped her arm free with a force that made even his wolf recoil. "Don't. Touch. Me." Her aura slammed into him, cold and merciless. "You think I'll stand here and watch you mate and breed her?" she hissed, every word a dagger. His throat bobbed. "She meant nothing." She laughed - sharp, broken, brutal. "Yeah? That's why you were fucking her in your office? Couldn't even hide the scent of your betrayal." "Ara, it was a mistake-" She stepped closer, eyes blazing. "Your mistakes come in episodes, Alpha. Season one, season two, season three. You don't make mistakes. You make choices." He swallowed hard. "I don't need her. I need you." "Lies," she spat. "Every damn sentence you breathe is a lie. I can't even look at you without feeling sick." He flinched like her words physically hit him. "That female behind you?" she pointed, not bothering to glance. "Perfect for you. Go mark her. Breed her. Hell, fuck her for all I care." Her voice cracked - but she kept going, blade steady even when bleeding. "I don't need you. Not anymore." His knees crashed to the floor. The mighty Alpha. On the ground. For her. "Ara... I'm sorry. I'm really fucking sorry." His voice broke like he finally understood what loss tasted like. She stared at him with a sad, devastating smile. "Isn't it too late for that, Mate?" One tear escaped - and she crushed it away with her thumb. Then she turned. Walked. Didn't look back. But he didn't chase her. Because he knew. He didn't just lose her. He wrecked her.

More details