Story cover for The Claim by ihareemnisar
The Claim
ihareemnisar
  • WpView
    Membaca 988,606
  • WpVote
    Vote 38,796
  • WpPart
    Bab 64
  • WpHistory
    Durasi 7h 27m
  • WpView
    Membaca 988,606
  • WpVote
    Vote 38,796
  • WpPart
    Bab 64
  • WpHistory
    Durasi 7h 27m
ihareemnisar
Lengkap, Awal publikasi Jan 04, 2017
bossclaimcrazygirldramafamiliesfightshappinesskinglovemarriagenawabpainpossesiveprotectorromancesaviourtexttospeech
His eyes scanned the room silently .The room was filled with colours. It was too bright for his taste.People were talking and laughing with each other.He was sitting quietly on the front like a King.His attitude and his personality screamed danger while his features showed a beautiful combination of dominance and sexiness.He was beautiful.His face screamed power,may be that's why people were too scared to come near him.His bodyguards stood protectively behind him ready to do anything waiting for his command.His eyes found no sign of danger ,he was about to relax when his eyes settled on a beauty laughing in a corner playing with a kid.He was unable to take his eyes off of her.His eyes assessed her shamelessly as she played with the kid oblivious to her surroundings.Her giggles were like honey floating in his ears.
    A smile automatically made its way upto his face as his mind settled its claim on her
Seluruh Hak Cipta Dilindungi Undang-Undang
bossclaimcrazygirldramafamiliesfightshappinesskinglovemarriagenawabpainpossesiveprotectorromancesaviourtexttospeech
Daftar isi

64 bab

Daftar untuk menambahkan The Claim ke perpustakaan kamu dan menerima pembaruan
atau
#6crazygirl
Panduan Muatan
anda mungkin juga menyukai
In His Shadows | 18+ oleh panchhii20
20 bab Bersambung Dewasa
I flickered my eyes as I could not see properly due to all the strain and stress. I could not make sense of the situation. I felt a sudden tug at my feet as I tried to pull them, realising that they were tied by the rope. My hands were free but there was a feeling of numbness in them. It was all so overwhleming and sudden for me that I felt like drowning in an ocean, where I did not want to be saved. The truth was in front of me and I didn't want to believe it. Sitting on the throne like chair in front of me was the person I trusted the most. My protector, my bodyguard, and now my captor. . . . I watched her opening her eyes slowly, trying to take in all the sitauation at once. My poor little doll, so fragile, so naive and innocent for this dark and dirty world, who has no idea that after years of being raised and treated like a fragile princess, she was now a part of this world, and I could not wait to break her. As her protector and her bodyguard, it would give me a sick pleasure in taking and ruining her. In His Shadows |18+| A Drak Romace Thriller
The Pregnant Bride oleh Avreet_B
50 bab Lengkap Dewasa
"Stay away from my daughters." He said, as the servant guided them away infront of my eyes. The ivory bangles in my arm clinked as I put the flick of my hair behind my ear. This would be what... the second argument for today? "You had a step father in your life, who you admire. Why can't I have that relation with your kids?" I spoke, crossing my arms over my chest, trying hard so that the tears in my eyes don't slip out. "Because I don't want them to be knocked up before they are married." He stated again. He shouldn't have gone there. Badtameez "Like your sister was?" I spoke again. My child maybe illegitimate but it wasn't unwanted. "The guy who knocked her up also married her. Which is not true in your case." He said, and walked out of the room as I sat there alone for the third night in the row. I wanted to call my dad, but I had ended all relations with them on my own free will. What would become of me now? Copyright- No parts of this book shall be copied without my permission. My books are only on Watppad and should not be found anywhere.
Mr Perfect's Crazy Wife oleh Author_Subha
32 bab Bersambung Dewasa
"Why are you just standing there?" she asked in a condescending tone. I looked at her face, trying to decipher the emotions behind her expression. There was no sadness, but something else that I couldn't quite pinpoint. "Is everything alright? Your marriage ended with your lover and began with me," I asked, hoping for some clarity. "Do you want me to cry?" she asked, nonchalantly settling herself on the bed. "No, not at all," I replied, smiling at her. Her next words caught me off guard and sent a wave of unease through me. "Strip," she commanded, a smirk playing on her lips. "What? I don't understand," I stammered, unsure if I had heard her correctly. Maybe I was experiencing some hearing problem. "Strip," she repeated, her eyes fixed on me, a mischievous glint in her gaze... Will Arjun be able to handle this whirlwind of energy, or will he decide to walk away? Join us as we discover how Arjun navigates life with this delightful and unpredictable girl
Mysteries Of Destiny oleh talesbyshiny
20 bab Bersambung Dewasa
To all the girls who were broken by boys but still yearn to be loved by men... _____________________________________________ She whispered, barely audible, "I'm sorry... I can't be a mother. I lost everything that evening." His expression darkened with fury for a moment jaw clenched, eyes blazing but the moment he looked at her, all that rage melted into something softer. Protective. Reverent. Gently, he cupped her cheek. "Who did this to you, Sparrow?" Tears streamed down her face. Her voice trembled. "I don't know. All I know is they were powerful filthy rich. They bought the silence of the court, twisted the truth, and blamed me for everything. Bunny... they stole my joy, my nights, my life." He didn't hesitate. Pulling out his phone, he spoke with lethal calm to his PA,"Burn down every damned courtroom in this country. Find the man who laid a hand on my Sparrow and end him."
Bey-Khudi🍁 oleh farahaha18
37 bab Lengkap
(Read at your own risk !! CRINGE ALERT🚨 ⚠️) Zaviyaan spotted Rooh near the entrance gate, She had a few bruises on her face. He didn't get time to notice her anymore when his legs dashed towards her on their own. Rooh was engulfed by Zaviyaan in a tight embrace. It wasn't like one of the bone crushing hugs they used to give each other. He was hugging her like his life was dependent on it. He scooped her up in his arms and hid her face in his chest sniffing her hair. He finally felt like he could breathe. "I would've died. I would've died . Rooh I would've died." he kept chanting making her eyes go wide. Everyone else was too shocked to do or say anything they knew things had gone too far now. ≧﹏≦ Zaviyaan Haider has endured so many disappointments in life that he has constructed ice tombs encircling his heart. Even his family didn't manage to melt the ice because it had become nearly impossible. But what happens when a tiny girl targets those tombs and begins shooting arrows of affection and devotion, shattering their foundation? Tropes : Age-gap ✨ Grumpy X Sunshine 🐣 She fell first 🐸 He fell harder 🤌
Falling for My Arrogant Mentor ( Book 2 #Raghuvanshi series) oleh KKatha123
18 bab Lengkap
Prologue " I want to tell you something important", a beautiful girl said, playing with her hair nervously,with a shy smile on her face. " Get out!!", the man said in a rude manner, making the girl shocked. " What??", she said with shocked expressions. " Don't you have manners?? I am your Mentor and not your friend ...how dare you enter my cabin without permission", he said,in a rude tone. She was shocked seeing his rude behaviour towards her. She thought everything had changed between them and she meant something to him,not just an intern under him. " I am sorry, Sir", she said, with an expressionless face. " Did you check the new patient's medical history?", he asked her in a professional tone. " No", she replied softly. " Then what the hell are you doing here?? You have no other work except roaming here and there. Go and finish your work otherwise I will be forced to remove you from the internship program", he said rudely, making her feel humiliated. " I will not repeat the same mistake, Sir", she said and left his cabin. As soon as she left his cabin, a lone tear slipped from her left eye. She wiped the tear with a stern face and left from there without looking behind. She is a Bubbly Intern and He is her Arrogant Mentor........ Will love blossom between them?? Full book is available on stck .... Copyrights ©️ 2024 by KKatha All rights reserved
Iɴғᴀᴛᴜᴀᴛɪᴏɴ ᴛᴜʀɴᴇᴅ Oʙsᴇssɪᴏɴ oleh writer_fantasia
97 bab Lengkap Dewasa
She is the radiant and free-spirited princess of Malwa-beautiful, bubbly, and blissfully unaware of the haunting truths buried in her past. Since childhood, she has been bound to a royal alliance with the prince of Madhya Pradesh-a commitment inked by fate, not by choice. He is the merciless King of Rajasthan-CEO by day, mafia lord by night. Ruthless, inhuman, and feared across the nation, he commands the underworld syndicate known as the Black Domain, where he's worshipped and dreaded as The Beast in Human Form. With a wicked smile, he slaughters like it's a sport-death means nothing to him. But what happens when fate dares to intertwine their worlds? What unfolds when two cold-blooded beasts cross paths... for one delicate, untouchable beauty? She flinches at the thought of crushing an ant. He slaughters men like they're insects beneath his boots. Their contrast is more than striking-it's cataclysmic. She is dawn. He is dusk. She is the warmth of spring. He is the chill of winter. She breathes life. He brings death. She is softness wrapped in silk, the only calm that can silence the storm in him. He is steel cloaked in shadows, a living fortress of pain and vengeance. And yet... she is the only one who dares to step into his darkness. The only one who can shatter the walls he built to cage his own heart. ꧁༺༻꧂★᭄ꦿ᭄ꦿ Tropes : - Villian in love - touch her and die - mafia romance - slow burn - she fell first but he fell harder - forced proximity - Mafia x Fashion designer - Grumpy x sunshine
His Little Love: (The first stage of obsession) oleh divy_679
33 bab Bersambung Dewasa
**She wrote, "I am not dumb, I just want some care too, I also want love and affection."** he want sex (the first part revolves around obsession and lust only.) 18+ "Do you know why I call you Little Love?" he whispers. His arms tighten around her waist from behind, a wolfish grin on his face. She shyly nods as her head nods no He laughs at the girl's innocence, caressing her bare belly. "because.." .... "y-you made me paint your portrait with b-blood of my cousin,m-mr archer ?" she shuddered as she stepped back, having fear and disbelief in her eyes, with tears flowing down He rolls his eyes and pinches her cheeks playfully, like it's a joke to him. "Come on, little love. He tried to touch you. tried to run away with you, when you are my wife in my castle." arrogant yet lovely tone. (HE IS A HOLY HELL PSYCHOPATH, LOVE THE SMELL AND COLOUR BLOOD, OBSESSED WITH A GIRL, KING) (SHE IS INNOCENT, MATURE YET CHILDISH, OBEDIENT AND LOVED BY EVERYONE CUZ OF HER INNOCENCE AND KINDNESS FOR EVERYONE) ⚠⚠⚠⚠⚠⚠⚠⚠⚠⚠⚠⚠⚠⚠⚠⚠⚠⚠⚠⚠⚠⚠⚠⚠⚠❗❗❗❗❗❗❗❗❗❗❗❗❗❗‼‼‼‼‼‼‼ THIS STORY IS FICTIONAL. I don't want to hurt anyone's emotions and beliefs. just frictional story. for fun. Please read it with a free mind. No fight, no insult. It's a story of a different universe, a different world. NOT RELATED TO REALITY. King of Britain and an innocent girl from India 90s... BRITAINxINDIA WE RESPECT EVERYONE. PEACE. LOVE. 18+, violence, crime, abuse, abusive words. triggers, bla, bla, bla.. see you . take care
IT WAS MEANT TO BE HIM oleh miraal1224
81 bab Lengkap Dewasa
"𝕀 𝕒𝕞 𝕥𝕙𝕖 𝕠𝕨𝕟𝕖𝕣 𝕠𝕗 𝕙𝕖𝕣 𝕖𝕒𝕔𝕙 𝕓𝕣𝕖𝕒𝕥𝕙 , 𝕤𝕙𝕖 𝕓𝕖𝕝𝕠𝕟𝕘𝕤 𝕥𝕠 𝕞𝕖" ----------------------------------------------------------------- "Neither she loves you nor she belongs to you" her ex fiancee shouted in anger. He stood up from his king-like chair and walked towards him in a casual demeanor...."But she moans my name pretty loudly at night!" He hissed near his ear in a devilish smirk!!!! "Why are you doing this Kabir...you are playing with her , you don't , in fact you can't love anyone" he said being heartbroken by his previous statement. Tck...tck ...tck....he laughed like a devil and said..." You are right I don't love her in fact I don't love anyone...but that has nothing to do with me having her in my bed , under me ,at my mercy and you know the best part , you my dear baby brother can't do anything about it!!! Follow this journey of madness and possessiveness !!!! Highest rank🥇 #1 in Wattpad #1 in maturethemes
The King's Captive Bride 🔞✓ oleh Storyteller_Shibangi
36 bab Lengkap Dewasa
A legendary King who saved their kingdom from brutal invaders and the humble brahmin's (ascetic) daughter. • King gets obsessed with her and forcefully marry her. • Strong female lead x Love sick Male lead. • FL tries to get revenge for what he does to her, follow the journey to see if she can escape from him, or fall for him. • Geographical location is Kashmir. ••• "Will you fight me too, your majesty?" A commanding voice cut through the crowd, drawing all eyes to the arena. At once, everyone knelt. "Hail to the savior of Kali Kingdom!" Shivani's gaze shifted, meeting her husband's smirking eyes. Dressed in green, he stood at the edge, watching her like a hunter sizing up his prey. Her smile faded, replaced by cold resolve. "I am not a warrior, Maharaja," she stated. "Just a teacher. My work here is done." "Rise," he ordered softly, eyes still locked on hers. As the men stood, he stepped forward, his smile deepening. "I, too, wish to learn. I shall pay a suitable fees. Don't worry." Her jaw tightened. "I have nothing to teach the great King," she said, laced with sarcasm. "I'm just a mere woman correcting mistakes-while you, of course, are flawless." Unfazed, he removed his rings one by one, handing them to a servant. "It's a humble request, Maharani. Please teach me. How can you judge my skill without facing me?" Her grip on the sword tightened. He had struck a nerve. "Fine," she snapped. With a sharp swing, she stepped back, putting space between them. A sword was placed in his hand. With a slight nod, he raised it, ready for battle. • • •
anda mungkin juga menyukai
Slide 1 of 10
In His Shadows | 18+ cover
The Pregnant Bride cover
Mr Perfect's Crazy Wife cover
Mysteries Of Destiny cover
Bey-Khudi🍁 cover
Falling for My Arrogant Mentor ( Book 2 #Raghuvanshi series) cover
Iɴғᴀᴛᴜᴀᴛɪᴏɴ ᴛᴜʀɴᴇᴅ Oʙsᴇssɪᴏɴ cover
His Little Love: (The first stage of obsession) cover
IT WAS MEANT TO BE HIM cover
The King's Captive Bride 🔞✓ cover

In His Shadows | 18+

20 bab Bersambung Dewasa

I flickered my eyes as I could not see properly due to all the strain and stress. I could not make sense of the situation. I felt a sudden tug at my feet as I tried to pull them, realising that they were tied by the rope. My hands were free but there was a feeling of numbness in them. It was all so overwhleming and sudden for me that I felt like drowning in an ocean, where I did not want to be saved. The truth was in front of me and I didn't want to believe it. Sitting on the throne like chair in front of me was the person I trusted the most. My protector, my bodyguard, and now my captor. . . . I watched her opening her eyes slowly, trying to take in all the sitauation at once. My poor little doll, so fragile, so naive and innocent for this dark and dirty world, who has no idea that after years of being raised and treated like a fragile princess, she was now a part of this world, and I could not wait to break her. As her protector and her bodyguard, it would give me a sick pleasure in taking and ruining her. In His Shadows |18+| A Drak Romace Thriller

Detail lengkap