Story cover for The Claim by ihareemnisar
The Claim
ihareemnisar
  • WpView
    Membaca 988,592
  • WpVote
    Vote 38,796
  • WpPart
    Bab 64
  • WpHistory
    Durasi 7h 27m
  • WpView
    Membaca 988,592
  • WpVote
    Vote 38,796
  • WpPart
    Bab 64
  • WpHistory
    Durasi 7h 27m
ihareemnisar
Lengkap, Awal publikasi Jan 04, 2017
bossclaimcrazygirldramafamiliesfightshappinesskinglovemarriagenawabpainpossesiveprotectorromancesaviourtexttospeech
His eyes scanned the room silently .The room was filled with colours. It was too bright for his taste.People were talking and laughing with each other.He was sitting quietly on the front like a King.His attitude and his personality screamed danger while his features showed a beautiful combination of dominance and sexiness.He was beautiful.His face screamed power,may be that's why people were too scared to come near him.His bodyguards stood protectively behind him ready to do anything waiting for his command.His eyes found no sign of danger ,he was about to relax when his eyes settled on a beauty laughing in a corner playing with a kid.He was unable to take his eyes off of her.His eyes assessed her shamelessly as she played with the kid oblivious to her surroundings.Her giggles were like honey floating in his ears.
    A smile automatically made its way upto his face as his mind settled its claim on her
Seluruh Hak Cipta Dilindungi Undang-Undang
bossclaimcrazygirldramafamiliesfightshappinesskinglovemarriagenawabpainpossesiveprotectorromancesaviourtexttospeech
Daftar isi

64 bab

Daftar untuk menambahkan The Claim ke perpustakaan kamu dan menerima pembaruan
atau
#6crazygirl
Panduan Muatan
anda mungkin juga menyukai
Mr Perfect's Crazy Wife oleh Author_Subha
32 bab Bersambung Dewasa
"Why are you just standing there?" she asked in a condescending tone. I looked at her face, trying to decipher the emotions behind her expression. There was no sadness, but something else that I couldn't quite pinpoint. "Is everything alright? Your marriage ended with your lover and began with me," I asked, hoping for some clarity. "Do you want me to cry?" she asked, nonchalantly settling herself on the bed. "No, not at all," I replied, smiling at her. Her next words caught me off guard and sent a wave of unease through me. "Strip," she commanded, a smirk playing on her lips. "What? I don't understand," I stammered, unsure if I had heard her correctly. Maybe I was experiencing some hearing problem. "Strip," she repeated, her eyes fixed on me, a mischievous glint in her gaze... Will Arjun be able to handle this whirlwind of energy, or will he decide to walk away? Join us as we discover how Arjun navigates life with this delightful and unpredictable girl
Mysteries Of Destiny oleh talesbyshiny
20 bab Bersambung Dewasa
To all the girls who were broken by boys but still yearn to be loved by men... _____________________________________________ She whispered, barely audible, "I'm sorry... I can't be a mother. I lost everything that evening." His expression darkened with fury for a moment jaw clenched, eyes blazing but the moment he looked at her, all that rage melted into something softer. Protective. Reverent. Gently, he cupped her cheek. "Who did this to you, Sparrow?" Tears streamed down her face. Her voice trembled. "I don't know. All I know is they were powerful filthy rich. They bought the silence of the court, twisted the truth, and blamed me for everything. Bunny... they stole my joy, my nights, my life." He didn't hesitate. Pulling out his phone, he spoke with lethal calm to his PA,"Burn down every damned courtroom in this country. Find the man who laid a hand on my Sparrow and end him."
Undeniably Yours oleh Moon5837
70 bab Lengkap Dewasa
"What the hell is this " Abhi said throwing some photos on the girl's face who was looking at photo than Abhi. " A.. Act.. " Before she can complete her sentence Abhi pushes her to wall standing dangerously closer to her. His hot breath started falling on her bare shoulder making her heartbeat fast, " Stop shuttering just answer my damn question. I want the truth only truth. " He said in dangerously calm voice making her more scared. " I... Actually she is not.. me... I mean the girl in the photo is not me. I was in this room. I never leave this room today..... As per your instructions. " She said finally looks down not able to meet his intense gaze. Abhi slipped his hand inside her dress putting it on her bare waist. " Mrs Singhania last chance, tell me the truth otherwise " He said taking his hand upward resting it on her curve . " I've my way to make you spill out the truth. " He whispers in her ears sensually.
THE THAKURANI_ROYAL VOWS oleh NAVITRIVEDI
26 bab Bersambung Dewasa
THE BETRAYAL ALWAYS COME FROM THE UNEXPECTED ONES WHEN WE FACE BETRAYAL OUR EYES DENIED TO SEE THAT OUR HEART START TO BLEED AND MIND IT STOP WORKING ~ ARADHYA RUDRANSH SINGH THAKUR I am waiting for her from the day she left from here, only she is going to become my wife no one can take her place or replace her. ~RUDRANSH SINGH THAKUR the royal love story where she born with her fate attached with him, and his life is surrounded around her if he decided to married someone else then he is going to destroy his own life. there fate are entangled with each other doesn't matter how much they run from each other they cant go away from there fate. she is going to his and thakurs protector always she is born only for your son ~kulguru he is magnet and I get easily attracted towards him I love him and can't live without him he is my life. ~ARADHYA RUDRANSH SINGH THAKUR I don't love you only getting married for my duties so don't get your expectation high from this marriage RANI SA ~RUDRANSH SINGH THAKUR she only get betrayals and love is something she only get from her adopted family is she able to get away from this betrayal and able to face the truth which she is hiding from everyone. KING(CEO)×MAFFIA QUEEN(CEO) COLD×RUDE( SOFT ONLY FOR FAMILY MEMBER) HEARTLESS× WARM MERCILESS×RUTHLESS DUTIFUL ×PROTECTIVE DON'T BELIEVE IN LOVE × LOVE HIM WITH FULL HEART
Iɴғᴀᴛᴜᴀᴛɪᴏɴ ᴛᴜʀɴᴇᴅ Oʙsᴇssɪᴏɴ oleh writer_fantasia
97 bab Lengkap Dewasa
She is the radiant and free-spirited princess of Malwa-beautiful, bubbly, and blissfully unaware of the haunting truths buried in her past. Since childhood, she has been bound to a royal alliance with the prince of Madhya Pradesh-a commitment inked by fate, not by choice. He is the merciless King of Rajasthan-CEO by day, mafia lord by night. Ruthless, inhuman, and feared across the nation, he commands the underworld syndicate known as the Black Domain, where he's worshipped and dreaded as The Beast in Human Form. With a wicked smile, he slaughters like it's a sport-death means nothing to him. But what happens when fate dares to intertwine their worlds? What unfolds when two cold-blooded beasts cross paths... for one delicate, untouchable beauty? She flinches at the thought of crushing an ant. He slaughters men like they're insects beneath his boots. Their contrast is more than striking-it's cataclysmic. She is dawn. He is dusk. She is the warmth of spring. He is the chill of winter. She breathes life. He brings death. She is softness wrapped in silk, the only calm that can silence the storm in him. He is steel cloaked in shadows, a living fortress of pain and vengeance. And yet... she is the only one who dares to step into his darkness. The only one who can shatter the walls he built to cage his own heart. ꧁༺༻꧂★᭄ꦿ᭄ꦿ Tropes : - Villian in love - touch her and die - mafia romance - slow burn - she fell first but he fell harder - forced proximity - Mafia x Fashion designer - Grumpy x sunshine
The Replacement oleh Shikhago
74 bab Lengkap Dewasa
Strip.. I look at him not believing what he said. I said strip.. He spoke with authority which I can't ignore. I stared discarding my clothes one by one shivering in fear. He look at me head to toe in disgust. You don't interest me anymore get out. This story is when a girl decide to to take all the pain of her husband and make him fall for her... But do you think is easy ? Will she able to to mend arrogant king ? Will she able to love him after knowing the darkness of his life ? Or she will brake her self in the process? Let's find out... Mature Content ⚠
Finding Love In An Arranged Marriage(Completed)✅ oleh Shrutigajendra
152 bab Lengkap Dewasa
❤️ Completed ❤️ She brings two coffee mugs in her hands and sees that he is busy with his work, she does not want to disturb him in any way, so she immediately goes to the balcony by places the coffee mug in front of him. But a very beautiful and shy smile always appears on her face whenever he is in front of her. She is pressing her lips under her teeth to control her rapid heartbeat. Takes his eyes off his laptop, watches her walk towards the balcony, and immediately holds his coffee mug and enjoys its fragrance for a while, with a smile, and sips it a little bit. He always loves her presence around him and deliberately shows that he is not noticing her. A wide smile starts crafting on his lips after remembering her shy smile which always enhances her beauty when she sees him. ****************************** He is driving too fast and with a strong jerk, he stops his car on a deserted road because he knows she is very disturbed today. She looked outside and cried silently. Then he forcibly makes the girl sitting next to him sit on his lap but as soon as she is sitting on his lap she starts hitting on his chest with her soft and small palms. She is very angry with him and wants to show her anger just like this. He also knows that he has made a mistake and is ready for this punishment. But he immediately grabs her nape and crushes his lips with her soft petals. She feels shocked but starts moving her lips with him while having a lot of tears in her eyes. ********************************* A journey from fighting to sweet banters. In short, it's just arranged marriage that turns into a very sweet journey.
In His Shadows | 18+ oleh panchhii20
20 bab Bersambung Dewasa
I flickered my eyes as I could not see properly due to all the strain and stress. I could not make sense of the situation. I felt a sudden tug at my feet as I tried to pull them, realising that they were tied by the rope. My hands were free but there was a feeling of numbness in them. It was all so overwhleming and sudden for me that I felt like drowning in an ocean, where I did not want to be saved. The truth was in front of me and I didn't want to believe it. Sitting on the throne like chair in front of me was the person I trusted the most. My protector, my bodyguard, and now my captor. . . . I watched her opening her eyes slowly, trying to take in all the sitauation at once. My poor little doll, so fragile, so naive and innocent for this dark and dirty world, who has no idea that after years of being raised and treated like a fragile princess, she was now a part of this world, and I could not wait to break her. As her protector and her bodyguard, it would give me a sick pleasure in taking and ruining her. In His Shadows |18+| A Drak Romace Thriller
The King's Captive Bride 🔞✓ oleh Storyteller_Shibangi
36 bab Lengkap Dewasa
A legendary King who saved their kingdom from brutal invaders and the humble brahmin's (ascetic) daughter. • King gets obsessed with her and forcefully marry her. • Strong female lead x Love sick Male lead. • FL tries to get revenge for what he does to her, follow the journey to see if she can escape from him, or fall for him. • Geographical location is Kashmir. ••• "Will you fight me too, your majesty?" A commanding voice cut through the crowd, drawing all eyes to the arena. At once, everyone knelt. "Hail to the savior of Kali Kingdom!" Shivani's gaze shifted, meeting her husband's smirking eyes. Dressed in green, he stood at the edge, watching her like a hunter sizing up his prey. Her smile faded, replaced by cold resolve. "I am not a warrior, Maharaja," she stated. "Just a teacher. My work here is done." "Rise," he ordered softly, eyes still locked on hers. As the men stood, he stepped forward, his smile deepening. "I, too, wish to learn. I shall pay a suitable fees. Don't worry." Her jaw tightened. "I have nothing to teach the great King," she said, laced with sarcasm. "I'm just a mere woman correcting mistakes-while you, of course, are flawless." Unfazed, he removed his rings one by one, handing them to a servant. "It's a humble request, Maharani. Please teach me. How can you judge my skill without facing me?" Her grip on the sword tightened. He had struck a nerve. "Fine," she snapped. With a sharp swing, she stepped back, putting space between them. A sword was placed in his hand. With a slight nod, he raised it, ready for battle. • • •
Silent Pain oleh ScarWind8
33 bab Lengkap Dewasa
Jason I started kissing her jaw but not kissing her lips, I like to tease her "Jason please... " she moans grabbing my hair. "Patience baby, do you know what I'm gonna do with you?". I keep assaulting her neck by bitting and sucking down her soft skin. In response she just moans and tilt her neck giving me more access. "You make me so hard when you moan", I started undressing her. "I'm gonna eat your pussy and when I'm done, you would be cumming so hard only with my mouth and my fingers". ________________ Jason Laszlo Knight is 29 years , a Billionaire and CEO of Knight Enterprises.Only works hard for his family. Everyone is afraid of him, treats women as objects. He is having a traumatic and painful past and is very reserved. But she changes everything and breaks the wall that he has build for years. Kira Regina White is 28 years, a surgeon and started practice in CityMed Hospital. Always busy with her work she doesn't live up her life. She helps people to go through their pain and understands them. She doesn't date anyone because of her past relationship. When they both cross path with each other, will they both be able to take away each others pain? Or will they cause more pain to each other? Explore the journey filled with joy, drama, pain, tears and love. Warning🚨 This story contains Mature scenes.
anda mungkin juga menyukai
Slide 1 of 10
Mr Perfect's Crazy Wife cover
Mysteries Of Destiny cover
Undeniably Yours cover
THE THAKURANI_ROYAL VOWS cover
Iɴғᴀᴛᴜᴀᴛɪᴏɴ ᴛᴜʀɴᴇᴅ Oʙsᴇssɪᴏɴ cover
The Replacement cover
Finding Love In An Arranged Marriage(Completed)✅ cover
In His Shadows | 18+ cover
The King's Captive Bride 🔞✓ cover
Silent Pain cover

Mr Perfect's Crazy Wife

32 bab Bersambung Dewasa

"Why are you just standing there?" she asked in a condescending tone. I looked at her face, trying to decipher the emotions behind her expression. There was no sadness, but something else that I couldn't quite pinpoint. "Is everything alright? Your marriage ended with your lover and began with me," I asked, hoping for some clarity. "Do you want me to cry?" she asked, nonchalantly settling herself on the bed. "No, not at all," I replied, smiling at her. Her next words caught me off guard and sent a wave of unease through me. "Strip," she commanded, a smirk playing on her lips. "What? I don't understand," I stammered, unsure if I had heard her correctly. Maybe I was experiencing some hearing problem. "Strip," she repeated, her eyes fixed on me, a mischievous glint in her gaze... Will Arjun be able to handle this whirlwind of energy, or will he decide to walk away? Join us as we discover how Arjun navigates life with this delightful and unpredictable girl

Detail lengkap