Story cover for The Claim by ihareemnisar
The Claim
ihareemnisar
  • WpView
    Reads 988,586
  • WpVote
    Votes 38,796
  • WpPart
    Parts 64
  • WpHistory
    Time 7h 27m
  • WpView
    Reads 988,586
  • WpVote
    Votes 38,796
  • WpPart
    Parts 64
  • WpHistory
    Time 7h 27m
ihareemnisar
Complete, First published Jan 04, 2017
bossclaimcrazygirldramafamiliesfightshappinesskinglovemarriagenawabpainpossesiveprotectorromancesaviourtexttospeech
His eyes scanned the room silently .The room was filled with colours. It was too bright for his taste.People were talking and laughing with each other.He was sitting quietly on the front like a King.His attitude and his personality screamed danger while his features showed a beautiful combination of dominance and sexiness.He was beautiful.His face screamed power,may be that's why people were too scared to come near him.His bodyguards stood protectively behind him ready to do anything waiting for his command.His eyes found no sign of danger ,he was about to relax when his eyes settled on a beauty laughing in a corner playing with a kid.He was unable to take his eyes off of her.His eyes assessed her shamelessly as she played with the kid oblivious to her surroundings.Her giggles were like honey floating in his ears.
    A smile automatically made its way upto his face as his mind settled its claim on her
All Rights Reserved
bossclaimcrazygirldramafamiliesfightshappinesskinglovemarriagenawabpainpossesiveprotectorromancesaviourtexttospeech
Table of contents

64 parts

Sign up to add The Claim to your library and receive updates
or
#943possesive
Content Guidelines
You may also like
Bey-Khudi🍁 by farahaha18
37 parts Complete
(Read at your own risk !! CRINGE ALERT🚨 ⚠️) Zaviyaan spotted Rooh near the entrance gate, She had a few bruises on her face. He didn't get time to notice her anymore when his legs dashed towards her on their own. Rooh was engulfed by Zaviyaan in a tight embrace. It wasn't like one of the bone crushing hugs they used to give each other. He was hugging her like his life was dependent on it. He scooped her up in his arms and hid her face in his chest sniffing her hair. He finally felt like he could breathe. "I would've died. I would've died . Rooh I would've died." he kept chanting making her eyes go wide. Everyone else was too shocked to do or say anything they knew things had gone too far now. ≧﹏≦ Zaviyaan Haider has endured so many disappointments in life that he has constructed ice tombs encircling his heart. Even his family didn't manage to melt the ice because it had become nearly impossible. But what happens when a tiny girl targets those tombs and begins shooting arrows of affection and devotion, shattering their foundation? Tropes : Age-gap ✨ Grumpy X Sunshine 🐣 She fell first 🐸 He fell harder 🤌
Mysteries Of Destiny by talesbyshiny
20 parts Ongoing Mature
To all the girls who were broken by boys but still yearn to be loved by men... _____________________________________________ She whispered, barely audible, "I'm sorry... I can't be a mother. I lost everything that evening." His expression darkened with fury for a moment jaw clenched, eyes blazing but the moment he looked at her, all that rage melted into something softer. Protective. Reverent. Gently, he cupped her cheek. "Who did this to you, Sparrow?" Tears streamed down her face. Her voice trembled. "I don't know. All I know is they were powerful filthy rich. They bought the silence of the court, twisted the truth, and blamed me for everything. Bunny... they stole my joy, my nights, my life." He didn't hesitate. Pulling out his phone, he spoke with lethal calm to his PA,"Burn down every damned courtroom in this country. Find the man who laid a hand on my Sparrow and end him."
IT WAS MEANT TO BE HIM by miraal1224
81 parts Complete Mature
"𝕀 𝕒𝕞 𝕥𝕙𝕖 𝕠𝕨𝕟𝕖𝕣 𝕠𝕗 𝕙𝕖𝕣 𝕖𝕒𝕔𝕙 𝕓𝕣𝕖𝕒𝕥𝕙 , 𝕤𝕙𝕖 𝕓𝕖𝕝𝕠𝕟𝕘𝕤 𝕥𝕠 𝕞𝕖" ----------------------------------------------------------------- "Neither she loves you nor she belongs to you" her ex fiancee shouted in anger. He stood up from his king-like chair and walked towards him in a casual demeanor...."But she moans my name pretty loudly at night!" He hissed near his ear in a devilish smirk!!!! "Why are you doing this Kabir...you are playing with her , you don't , in fact you can't love anyone" he said being heartbroken by his previous statement. Tck...tck ...tck....he laughed like a devil and said..." You are right I don't love her in fact I don't love anyone...but that has nothing to do with me having her in my bed , under me ,at my mercy and you know the best part , you my dear baby brother can't do anything about it!!! Follow this journey of madness and possessiveness !!!! Highest rank🥇 #1 in Wattpad #1 in maturethemes
Silent Pain by ScarWind8
33 parts Complete Mature
Jason I started kissing her jaw but not kissing her lips, I like to tease her "Jason please... " she moans grabbing my hair. "Patience baby, do you know what I'm gonna do with you?". I keep assaulting her neck by bitting and sucking down her soft skin. In response she just moans and tilt her neck giving me more access. "You make me so hard when you moan", I started undressing her. "I'm gonna eat your pussy and when I'm done, you would be cumming so hard only with my mouth and my fingers". ________________ Jason Laszlo Knight is 29 years , a Billionaire and CEO of Knight Enterprises.Only works hard for his family. Everyone is afraid of him, treats women as objects. He is having a traumatic and painful past and is very reserved. But she changes everything and breaks the wall that he has build for years. Kira Regina White is 28 years, a surgeon and started practice in CityMed Hospital. Always busy with her work she doesn't live up her life. She helps people to go through their pain and understands them. She doesn't date anyone because of her past relationship. When they both cross path with each other, will they both be able to take away each others pain? Or will they cause more pain to each other? Explore the journey filled with joy, drama, pain, tears and love. Warning🚨 This story contains Mature scenes.
The Pregnant Bride by Avreet_B
50 parts Complete Mature
"Stay away from my daughters." He said, as the servant guided them away infront of my eyes. The ivory bangles in my arm clinked as I put the flick of my hair behind my ear. This would be what... the second argument for today? "You had a step father in your life, who you admire. Why can't I have that relation with your kids?" I spoke, crossing my arms over my chest, trying hard so that the tears in my eyes don't slip out. "Because I don't want them to be knocked up before they are married." He stated again. He shouldn't have gone there. Badtameez "Like your sister was?" I spoke again. My child maybe illegitimate but it wasn't unwanted. "The guy who knocked her up also married her. Which is not true in your case." He said, and walked out of the room as I sat there alone for the third night in the row. I wanted to call my dad, but I had ended all relations with them on my own free will. What would become of me now? Copyright- No parts of this book shall be copied without my permission. My books are only on Watppad and should not be found anywhere.
Arrange marriage 💜❤️ by PriyaGupta818
83 parts Complete Mature
STOP RIGHT THERE Mrs Priya Ekaansh Raghuvanshi, a shiver ran down her spine listening his dangerous voice she gulp and tightly close her eyes,she was clutching her saree in her hands that her life depend on it. When she stop at her place but didn't turn then he marched towards her with long strides , he holds her wrist in his tight grip without hurting her he pull her towards him that she collided with his chest she put her one hand on his chest so that she didn't fall. She open her eyes immediately because of his sudden pull,her brown doe like eyes meet with his black and dark eyes which is showing nothing but anger and hurt. But she was not able to maintain an eye contact with him so she immediately look down on her hand which was on his chest. Why the hell are you ignoring me since evening Mrs Raghuvanshi care to explain??he asked with irritating and slight anger in his voice. But she didn't said anything,she was Just looking down,she bite her lower lip in nervousness and his close proximity isn't helping at all. When he didn't get any answer from her he hold her shoulder and yelled at her ANSWER ME DAMMIT. Ji.....ji...wohh....main...she said stammering tears fall from her eyes.because it's her first time seeing his anger. when an innocent and shy girl is arranged into marriage with cold and top most sexiest businesses tycoon. "It is typical arrange marriage without any enemy it's just normal marriage life". let's see how love is going to bloom in both of their hearts. Let's see if he is cold with her also or not??? #6- family #1- Hindi #1-india #14- arrange marriage #10-love life #4- cute romance #3- wife
His Little Love: (The first stage of obsession) by divy_679
33 parts Ongoing Mature
**She wrote, "I am not dumb, I just want some care too, I also want love and affection."** he want sex (the first part revolves around obsession and lust only.) 18+ "Do you know why I call you Little Love?" he whispers. His arms tighten around her waist from behind, a wolfish grin on his face. She shyly nods as her head nods no He laughs at the girl's innocence, caressing her bare belly. "because.." .... "y-you made me paint your portrait with b-blood of my cousin,m-mr archer ?" she shuddered as she stepped back, having fear and disbelief in her eyes, with tears flowing down He rolls his eyes and pinches her cheeks playfully, like it's a joke to him. "Come on, little love. He tried to touch you. tried to run away with you, when you are my wife in my castle." arrogant yet lovely tone. (HE IS A HOLY HELL PSYCHOPATH, LOVE THE SMELL AND COLOUR BLOOD, OBSESSED WITH A GIRL, KING) (SHE IS INNOCENT, MATURE YET CHILDISH, OBEDIENT AND LOVED BY EVERYONE CUZ OF HER INNOCENCE AND KINDNESS FOR EVERYONE) ⚠⚠⚠⚠⚠⚠⚠⚠⚠⚠⚠⚠⚠⚠⚠⚠⚠⚠⚠⚠⚠⚠⚠⚠⚠❗❗❗❗❗❗❗❗❗❗❗❗❗❗‼‼‼‼‼‼‼ THIS STORY IS FICTIONAL. I don't want to hurt anyone's emotions and beliefs. just frictional story. for fun. Please read it with a free mind. No fight, no insult. It's a story of a different universe, a different world. NOT RELATED TO REALITY. King of Britain and an innocent girl from India 90s... BRITAINxINDIA WE RESPECT EVERYONE. PEACE. LOVE. 18+, violence, crime, abuse, abusive words. triggers, bla, bla, bla.. see you . take care
Iɴғᴀᴛᴜᴀᴛɪᴏɴ ᴛᴜʀɴᴇᴅ Oʙsᴇssɪᴏɴ by writer_fantasia
97 parts Complete Mature
She is the radiant and free-spirited princess of Malwa-beautiful, bubbly, and blissfully unaware of the haunting truths buried in her past. Since childhood, she has been bound to a royal alliance with the prince of Madhya Pradesh-a commitment inked by fate, not by choice. He is the merciless King of Rajasthan-CEO by day, mafia lord by night. Ruthless, inhuman, and feared across the nation, he commands the underworld syndicate known as the Black Domain, where he's worshipped and dreaded as The Beast in Human Form. With a wicked smile, he slaughters like it's a sport-death means nothing to him. But what happens when fate dares to intertwine their worlds? What unfolds when two cold-blooded beasts cross paths... for one delicate, untouchable beauty? She flinches at the thought of crushing an ant. He slaughters men like they're insects beneath his boots. Their contrast is more than striking-it's cataclysmic. She is dawn. He is dusk. She is the warmth of spring. He is the chill of winter. She breathes life. He brings death. She is softness wrapped in silk, the only calm that can silence the storm in him. He is steel cloaked in shadows, a living fortress of pain and vengeance. And yet... she is the only one who dares to step into his darkness. The only one who can shatter the walls he built to cage his own heart. ꧁༺༻꧂★᭄ꦿ᭄ꦿ Tropes : - Villian in love - touch her and die - mafia romance - slow burn - she fell first but he fell harder - forced proximity - Mafia x Fashion designer - Grumpy x sunshine
The King's Captive Bride 🔞✓ by Storyteller_Shibangi
36 parts Complete Mature
A legendary King who saved their kingdom from brutal invaders and the humble brahmin's (ascetic) daughter. • King gets obsessed with her and forcefully marry her. • Strong female lead x Love sick Male lead. • FL tries to get revenge for what he does to her, follow the journey to see if she can escape from him, or fall for him. • Geographical location is Kashmir. ••• "Will you fight me too, your majesty?" A commanding voice cut through the crowd, drawing all eyes to the arena. At once, everyone knelt. "Hail to the savior of Kali Kingdom!" Shivani's gaze shifted, meeting her husband's smirking eyes. Dressed in green, he stood at the edge, watching her like a hunter sizing up his prey. Her smile faded, replaced by cold resolve. "I am not a warrior, Maharaja," she stated. "Just a teacher. My work here is done." "Rise," he ordered softly, eyes still locked on hers. As the men stood, he stepped forward, his smile deepening. "I, too, wish to learn. I shall pay a suitable fees. Don't worry." Her jaw tightened. "I have nothing to teach the great King," she said, laced with sarcasm. "I'm just a mere woman correcting mistakes-while you, of course, are flawless." Unfazed, he removed his rings one by one, handing them to a servant. "It's a humble request, Maharani. Please teach me. How can you judge my skill without facing me?" Her grip on the sword tightened. He had struck a nerve. "Fine," she snapped. With a sharp swing, she stepped back, putting space between them. A sword was placed in his hand. With a slight nod, he raised it, ready for battle. • • •
You may also like
Slide 1 of 9
Bey-Khudi🍁 cover
Mysteries Of Destiny cover
IT WAS MEANT TO BE HIM cover
Silent Pain cover
The Pregnant Bride cover
Arrange marriage 💜❤️ cover
His Little Love: (The first stage of obsession) cover
Iɴғᴀᴛᴜᴀᴛɪᴏɴ ᴛᴜʀɴᴇᴅ Oʙsᴇssɪᴏɴ cover
The King's Captive Bride 🔞✓ cover

Bey-Khudi🍁

37 parts Complete

(Read at your own risk !! CRINGE ALERT🚨 ⚠️) Zaviyaan spotted Rooh near the entrance gate, She had a few bruises on her face. He didn't get time to notice her anymore when his legs dashed towards her on their own. Rooh was engulfed by Zaviyaan in a tight embrace. It wasn't like one of the bone crushing hugs they used to give each other. He was hugging her like his life was dependent on it. He scooped her up in his arms and hid her face in his chest sniffing her hair. He finally felt like he could breathe. "I would've died. I would've died . Rooh I would've died." he kept chanting making her eyes go wide. Everyone else was too shocked to do or say anything they knew things had gone too far now. ≧﹏≦ Zaviyaan Haider has endured so many disappointments in life that he has constructed ice tombs encircling his heart. Even his family didn't manage to melt the ice because it had become nearly impossible. But what happens when a tiny girl targets those tombs and begins shooting arrows of affection and devotion, shattering their foundation? Tropes : Age-gap ✨ Grumpy X Sunshine 🐣 She fell first 🐸 He fell harder 🤌

More details