Story cover for Role Plays! by The_Imagination_Void
Role Plays!
The_Imagination_Void
  • WpView
    Reads 485
  • WpVote
    Votes 14
  • WpPart
    Parts 11
  • WpHistory
    Time 18m
  • WpView
    Reads 485
  • WpVote
    Votes 14
  • WpPart
    Parts 11
  • WpHistory
    Time 18m
The_Imagination_Void
Ongoing, First published Jan 20, 2017
catsfandomsfivenightsatfreddysfnafmlpmylittleponyfimplaypokemonroleroleplayrpthelastguardiantruebraveryundertalewarriorcatswarriors
I LOVE TO RP TOO MUCH!
If you want me to open an RP Page fur a certain game/book, PM me!
All Rights Reserved
catsfandomsfivenightsatfreddysfnafmlpmylittleponyfimplaypokemonroleroleplayrpthelastguardiantruebraveryundertalewarriorcatswarriors
Table of contents

11 parts

Sign up to add Role Plays! to your library and receive updates
or
#43thelastguardian
Content Guidelines
You may also like
𝐒𝗺𝐢𝐥𝐢𝐧𝐠✯𝐂𝐫𝐢𝐭𝐭𝐞𝐫𝐬 𝐒𝐭𝐮𝐟𝐟-!! by Ambysz
34 parts Complete
Smiling Critters oneshots, fanfics, etc. I take requests(I'll update this whenever I'm not taking them) [I'm not currently taking requests ^_^]
Intentions ~ SapnapxReader by Nads180
32 parts Complete Mature
"𝐼 𝓁𝑜𝓋𝑒 𝓎𝑜𝓊, 𝒮𝒶𝓅𝓃𝒶𝓅..." ⚠️THERE WILL BE TWs AND SMUT⚠️ If Sapnap is uncomfortable with this, I will take it down immediately. Thank you guys for taking the time to read! INCLUDES: smut, fluff, romance, and friendship! Edit: I've decided that I don't care how many chapters I put out a day, if I feel like publishing 5 chapters so be it lol
My Oc Rp Book by Outlander234
198 parts Ongoing Mature
It has gotten hard for me to remember all my ocs so I've decided to make this book and any new ocs I make will be added. Also this doubles as a rp book so any rp books I currently have will be deleted once I transfer the ocs over. None of the images are mine.
The Unusual Pony (MLP x Male reader) by Creamyrose22
30 parts Ongoing Mature
Yeah I like MLP so what? Here have a story about it!
AppleDash ~ Worth The Wait (REMAKE!) (COMPLETE) by Mimi_5550
58 parts Complete
This is a remake of the one I first started and created back in 2019 but (HOPEFULLY) better You can suggest for me to add certain things in from the original story into this or if you'd rather me remove certain information instead that's fine Thank You for all the support on the original with (currently - 2024 March 12) 1.4K reads Update - 1.64K views as of 18th of December 2024 Please read this story if you liked the original Enjoy! Start ~ 18th of December 2024 End ~ 2nd of September 2025 #2 in flutterdash #38 in mlp
Fandoms React by Bluewolf202011
31 parts Complete
I bring in a bunch of characters from different fandoms to react to things about them and/or others. At the begining it is just mha but as time passes I will add other fandoms. Enjoy :) Fandoms inside: Avengers My hero academia Undertale/Glitchtale(my AU) Hazbin Hotel Five nights at Freddys
Sunrise/Moondrop x Reader (Fnaf Security Breach) by Jul1anT00ns
10 parts Complete
!!NOT CONTINUEING!! Im sorry to inform everyone that im not gonna be continuing this series due to my writing burn out and me being out of the fnaf fandom. i hope you all understand. And why not check out My Dreams on my profile? it's a dream journal and is actually the first ever book i published here on wattpad. But anyways, enjoy my x reader :> cover art made by me IM DOIN THIS FOR MY FELLOW SIMPS I GOTCHU FAMS ✊✊✊✊
Equestria's Alicorn Colt by TheMoonGaizer
28 parts Ongoing
After a horrible sequence of events unfolds an alicorn colt with no memory has woken up inside the everfree forest With no interactions with anybody from the outside how will this colt ever survive? Go along the journey of the mlp series and witness the greatest character development each chapter. Keep in mind this story will be a lot darker than the show, but it's to the point where it still feels like MLP. It's time to become OP! Big Inspiration from Seraphina0901, PLEASE go check hers out first it's so good! Disclaimer: I do not own anything in MLP everything belongs to Hasbro Started: May 15th, 2022 Ended: TBD
Fandom Individual RP Book OPEN by PeaceGirl614
82 parts Ongoing
This is basically a second part to my Individual RP book. I'm moving all of my Fandom Related OC's here to make space in my other book.
Gametoons poppy playtime rp by Gaminggirl855
194 parts Ongoing
We really need more gametoons poppy playtime and rainbow friends books
You may also like
Slide 1 of 10
𝐒𝗺𝐢𝐥𝐢𝐧𝐠✯𝐂𝐫𝐢𝐭𝐭𝐞𝐫𝐬 𝐒𝐭𝐮𝐟𝐟-!! cover
Intentions ~ SapnapxReader cover
My Oc Rp Book cover
The Unusual Pony (MLP x Male reader) cover
AppleDash ~ Worth The Wait (REMAKE!) (COMPLETE) cover
Fandoms React cover
Sunrise/Moondrop x Reader (Fnaf Security Breach) cover
Equestria's Alicorn Colt cover
Fandom Individual RP Book OPEN cover
Gametoons poppy playtime rp cover

𝐒𝗺𝐢𝐥𝐢𝐧𝐠✯𝐂𝐫𝐢𝐭𝐭𝐞𝐫𝐬 𝐒𝐭𝐮𝐟𝐟-!!

34 parts Complete

Smiling Critters oneshots, fanfics, etc. I take requests(I'll update this whenever I'm not taking them) [I'm not currently taking requests ^_^]

More details