The Rise of the Dawnstar (The Avalonia Chronicles #2)
FarahOomerbhoy
  • Reads 30,507
  • Votes 1,295
  • Parts 6
  • Time 51m
  • Reads 30,507
  • Votes 1,295
  • Parts 6
  • Time 51m
FarahOomerbhoy
Complete, First published Jan 21, 2017
academycentaursfaefantasyfantasyworldfriendshiphighfantasykingmagemagicnobilitypegasusprinceprincessroyalroyalbloodroyaltyschool
⭐️Silver award winner in IBPA's Benjamin Franklin Awards 2018, Finalist in the 2018 EPIC eBook Awards, Notable Indie in Self Unbound's 2018 Best Indie Book, Silver Medal winner in the 2017 Moonbeam Children's Book Awards & Bronze Medal winner in the 2017 Readers' Favorite Book Award⭐️

Aurora Firedrake returns in the spellbinding sequel to The Last of the Firedrakes.

The seven kingdoms of Avalonia are crumbling and evil is spreading across the land like a plague. Queen Morgana is close to finding a way to open the Book of Abraxas and it's only a matter of time until she uses the power trapped inside its pages to enslave the entire world.

With Avalonia growing more dangerous by the day, Aurora must travel through war-torn lands and deep into the heart of the fae kingdom of Elfi. Her goal is to find a legendary weapon infused with the last of the realm's ancient magic-the only weapon in the world powerful enough to stop the queen.

Aurora might have survived her first battle against Morgana, but the true fight to save her kingdom and restore her throne has only just begun...

You can now purchase The Rise of the Dawnstar in ebook, hardcover, paperback, and audiobook format at Amazon, Barnes and Noble, Apple, Kobo, and more.
All Rights Reserved
academycentaursfaefantasyfantasyworldfriendshiphighfantasykingmagemagicnobilitypegasusprinceprincessroyalroyalbloodroyaltyschool
Table of contents

6 parts

Sign up to add The Rise of the Dawnstar (The Avalonia Chronicles #2) to your library and receive updates
or
#20centaurs
Content Guidelines
You may also like
Visions of Dragons (Taming Beasts 1) by dollynightmares
13 parts Complete Mature
PUBLISHED ON AMAZON/BARNES & NOBLE! BUY NOW!! Born in a world of darkness and locked in a tower because of a curse, Vrai yearns to be set free and experience the world and meet new people. Only her wishes come true but not in a way she would have ever envisioned. She is set free from the tower to discover more betrayal from her own flesh and blood, her father. He has offered her and her sisters to the terrible and cruel fire dragon, Orval, King of Oria, which borders their own kingdom, Yulor, home to ice mages. Since the beginning of history before kingdoms have been named and borders had been drawn, dragons have been an enemy to her people, so it is the hope of her father she or her sisters can appease the dragon king, ending the war. However, little does she know the dragon king would be choosing her to be his queen. Though can love be found in a clash of fire and ice?
A Clash Of Light And Thunder (War Of The Forgotten Lovers Book 1) by AzulMidnight
43 parts Complete Mature
Featured in Wattpad HighFantasy & Magic II 19-year-old Aria is ready to accept her doomed fate of marrying the cruel Lord Lathik. An alliance that will secure a large army for her hateful brother's war against the fae. When destiny intervenes and her carriage gets attacked by bandits, she falls into fae territory. Pulled from the grasp of death and captured by the handsome crown prince, she can only pray he will never find out she is the enemy kingdom's princess. The fae prince, Elvin, is haunted by his mother's final words of a great war to come, of lies told, and a girl with redwood hair at the center of it all. When he saves a human that fits that description with rare light magic powers, he must decipher if she will be a friend or a foe. Is there something more to the lingering pull they feel towards each other? Will years of hate between humans and fae win out? How are their fates intertwined by the past? -----.------- "Do you know what you are asking?" Elvin's baritone voice vibrated down Aria's back. His velvet tone trickled down her skin like a gentle touch. "Yes... I want to know. What it feels like to be held with care." Aria truly did want to know... this may be the only chance she would get. ------.------ War Of The Forgotten Lovers Book 1 Best Rankings: #1 out of 6.5k in Fae 09/07/21 #1 out of 14.3k in Elf 10/02/21 #1 out of 18.7 in FantasyAdventure 10/01/21 #8 out of 87.9K in YoungAdult 09/13/21 EDITING
Alpheus Academy by AlexandraLexinn
29 parts Ongoing
No matter how much we ignore our past, it will keep coming back to us. Past that erased what we were before and made us who we are today. -- Two ladies who kept ignoring the truth in front of them were suddenly approached by danger. At an unexpected time of the day, their two love ones were abducted by an unknown creature who completely does not belong in their world. Unable to save them, Kairus, Krystel's brother, ordered them to go to Peldovia to save their parents. With that, they were ordered to enter Alpheus Academy. As they enter a different world with unfamiliar people surrounding them. Will they be able to succeed in their mission? Or fail them that can even result in their own death? Status: On-Going Released: October 05, 2021. Ended: --
The Bane of the Empire by AnnyVirdi
41 parts Complete
The world is ruled by a tyrant King. The Old King was killed and with him the magic that coursed through the world was sealed away. Dawn Rentradie, a human girl, is sent to Eastmaw to collect a tome that triggers a sequence of events that places her in the path of a Fae warrior named Hunter. Follow Dawn, as she uncovers the secrets of a world just out of reach but all around her. Turns out magic wasn't just a children's story. Genre: Young adult, High Fantasy, Adventure, Romance, Fae Folklore
Wicked Winter Book. 1 by AshtonMarie
30 parts Complete Mature
{Completed} Highest Ranking: # 1 in Fantasy (01/28/17) Book. 1 My blood boiled at the thought of one of them in our streets, hidden in plain sight, perhaps even by one of the kids from the orphanages. Would it murder innocent human children? You bet. Would it even think twice about gutting a starving child? Never. What could do this, you're probably asking. But it boils down to one single word. One word that made anger I hadn't known I possessed, roar to life like a pissed off lion. One word that sent a cold chill spider-walking down my spine. Faeries. ------------ Eve Scotts's world is divided by magic - The Order of the Seven who rules over her kingdom with a steel fist and the murderous faeries's she'll be forced to fight when she turns eighteen. Eve is a dueler, a human that dabbles in the elements to fight in underground scuffles for some extra coin to feed her fellow orphans back home. But she has a secret weapon: She can wield ice magic - a magic that is only reserved for the High Witches at court. But she makes a mistake. She exposes herself. Rumors are spreading of a small orphan girl who can wield the power of ice, and it isn't long until the Order sends one of their own to snatch up the bounty. In exchange for the secrecy of her special gift, Eve agrees to participate in the Witches Academy, where humans are taught to wield the power of the elements and become powerful witch soldiers for the Order's disposal. As Eve is drawn further into the Witch world, she risks everything to learn more about her power and her lineage. With her frozen heart melting for the Count of Night, Sebastian O'Neill, Eve is thrown into a cyclone of love, betrayal, and family drama she hadn't even known an orphan could inherit. Soon, Eve must decide: Is love, or survival more important? Word Count: 102,000.
Abbernathy and the Cat Kingdom |Trilogy Now Complete! by OctaviaLocke
51 parts Complete
One girl. Two cats. A world full of adventure. Abbernathy Tells is a twelve year old girl who prefers the companionship of her two cats and a dying tree over others her age. When a horrible tragedy strikes on her thirteenth birthday, robbing her of everything she holds dear, Abby is thrust into a world of walking, talking cat creatures on the brink of war. Accompanied by her two cats and a failing wizardess, Abby will embark on a journey to unravel the mysteries behind the magical kingdom of Aelurus, while trying to cope with loss, loneliness, and the butterflies that come from a certain boy's touch. This is Abbernathy and the Cat Kingdom. *Welcome. Please be sure to leash your dog(s).* ☆ (2/11/2019) First Draft Completed ☆ Amazing GIF Banner by @winterinheaven ☆ ☆ Chapter Breaks by @avadel ☆
Girl of Flower and Flame by TAJoseph
16 parts Ongoing
Stolen as a gift for the faerie prince, Eulalia's only hope of returning home is to become a spy for the rebel army and learn the prince's plans for war, but the more she's with him her contempt wilts, putting herself and many others in danger. *** After being stolen as a gift for the faerie prince, Eulalia gets embroiled in a brewing civil war when she befriends the handmaidens who are secretly a part of the rebel army. Convinced that befriending the prince will help their cause and get her home, Eulalia goes undercover as a spy. But as tensions between the high born and low born faes rise, Eulalia becomes tangled in between, discovering that the prince isn't quite the person she thought, and her new friends haven't been entirely honest. Copyright © 2024 T.A. Joseph All rights reserved
The Realms [Watty 2017 Shortlist] by RElizabethM
45 parts Complete
One mistake changes Hannah's life forever, exiling her from her realm and isolating her from the man who loves her. Now, Hannah must find a way to restore Ryan's memories and get them both back home before she loses everything forever. After threatening Ryan's father, the Ruler of the Realms, Hannah is transplanted into a new life in the Second Realm. Unable to get through to Ryan or to find her way back to her birth realm, Hannah enlists the help of Maizie, another banished soul who has some secrets of her own. Hannah knows that Ryan's father is abusing his power on the Third Realm and she intends to stop him, no matter the cost. Seeking out the Keepers of the Realms, Hannah and Maizie are drawn into a web of deception that leaves Hannah struggling to find the right path for herself and Ryan. Hannah's choices could save Ryan and the Third Realm but may leave her facing an uncertain future. What have people been saying about The Realms? *This book is awesome. I wish I could erase my memory of it and start it all over again - alubenlanretni *I loved this book - a3griffin32 *This is so amazing. You are truly talented - collettekozuchlepley *Love love loved this book! - shantelle721 *Loved the book! I was anxious to see what was coming next and was not disappointed when it did! - nicoleblakebontaine #5 in Adventure - January 26th, 2017 Third Place - 2016 Undiscovered Writers Awards in Adventure Featured story December 2016 - July 2017. Watty Awards Shortlist 2017 Cover by @pipo_here_
The Last of the Firedrakes [Watty Award Winner 2015] by FarahOomerbhoy
45 parts Complete
⭐️Silver Medal winner in the 2016 Readers' Favorite Book Award, Silver award winner in IBPA's 2016 Benjamin Franklin Awards, Semifinalist Winner in the 2016 Kindle Book Award, Finalist in the 2015 USA Best Book Awards, Winner in Wattpad's 2015 Watty Awards, Awesome Indies Approved & A Wattpad Featured Story⭐️ She never felt like she belonged...until magic pulled her into a world beyond her wildest imagination. Perfect for fans of the Throne of Glass series and the Grisha Trilogy. Sixteen-year-old Aurora wishes she were anyone else. Mistreated by her adopted family and bullied at school, she believes things can't get any worse. But when she's kidnapped and dragged through an ancient tapestry into the magical world of Avalonia, she soon discovers that some dreams can easily turn into nightmares. Hunted by the evil tyrant Queen Morgana, who will stop at nothing to get rid of the last surviving heir to the powerful Firedrake dynasty, Aurora struggles to fit into her new life as a mage at the prestigious Academy of Evolon. Threatened by treachery at every turn and desperate to prove herself worthy, she uncovers a dark, complicated web of political intrigue that threatens the very existence of the seven kingdoms of Avalonia. Aided by the powerful Duke of Silverthorne, a fae friend, and a handsome but mysterious outlaw called the Black Wolf, Aurora struggles to master her magic and get her rare powers under control before it's too late. If she fails, her new home and her family will be enslaved forever... The Last of the Firedrakes is the first novel in The Avalonia Chronicles series of enchanting YA fantasies. If you like resilient heroines, plentiful magic, immortal fae warriors, and sizzling romance you'll love Farah Oomerbhoy's enthralling story. You can now purchase The Last of The Firedrakes in ebook, hardcover, paperback, and audiobook format at Amazon, Barnes and Noble, Apple, Kobo, and more.
Secret of the Snow Queen (Fire and Ice Book #1) by Galaxia-Gwen
51 parts Ongoing Mature
In a land where power and deception reign supreme, two unlikely heroes find their fates intertwined in a battle against a malevolent force. Kelvin, a daring thief, gets caught in a perilous mission to steal a prized horse, only to discover that his father, the commander of the army, holds his fate. Faced with a choice between execution or joining a rebellion, Kelvin is thrust into a world of warfare and treachery. As he navigates the dangers of battle and espionage, Kelvin's path crosses with powerful figures and long-buried secrets, forcing him to confront his past and his true allegiance. Aurora, pregnant and desperate, flees from her abusive captor, only to fall into the hands of her sinister former guardian, Morgana. Trapped in Morgana's lair, Aurora's resilience is tested as she battles her tormentor's dark magic and her own fears. Her escape hinges on the unlikely help of Vladimir, a guard with a mysterious allegiance. As Aurora's journey unfolds, she uncovers hidden truths about her lineage and the dangerous legacy of the Snow Queen. Their separate paths converge in a tumultuous struggle against the forces of darkness. With the looming threat of the Snow Queen and the rebellion's fight for freedom, Kelvin and Aurora must navigate a web of alliances and betrayals. Will they uncover the secrets that bind their destinies and overcome the shadows that threaten their world? Secret of the Snow Queen is an epic tale of courage, magic, and the unyielding fight for freedom. Dive into a world where every choice carries immense stakes, and where the true strength of the heart is tested against the chilling forces of evil.
You may also like
Slide 1 of 10
Visions of Dragons (Taming Beasts 1) cover
A Clash Of Light And Thunder (War Of The Forgotten Lovers Book 1) cover
Alpheus Academy cover
The Bane of the Empire cover
Wicked Winter Book. 1 cover
Abbernathy and the Cat Kingdom |Trilogy Now Complete! cover
Girl of Flower and Flame cover
The Realms [Watty 2017 Shortlist] cover
The Last of the Firedrakes [Watty Award Winner 2015] cover
Secret of the Snow Queen (Fire and Ice Book #1) cover

Visions of Dragons (Taming Beasts 1)

13 parts Complete Mature

PUBLISHED ON AMAZON/BARNES & NOBLE! BUY NOW!! Born in a world of darkness and locked in a tower because of a curse, Vrai yearns to be set free and experience the world and meet new people. Only her wishes come true but not in a way she would have ever envisioned. She is set free from the tower to discover more betrayal from her own flesh and blood, her father. He has offered her and her sisters to the terrible and cruel fire dragon, Orval, King of Oria, which borders their own kingdom, Yulor, home to ice mages. Since the beginning of history before kingdoms have been named and borders had been drawn, dragons have been an enemy to her people, so it is the hope of her father she or her sisters can appease the dragon king, ending the war. However, little does she know the dragon king would be choosing her to be his queen. Though can love be found in a clash of fire and ice?

More details