The Rise of the Dawnstar (The Avalonia Chronicles #2)
FarahOomerbhoy
  • Reads 30,539
  • Votes 1,295
  • Parts 6
  • Time 51m
  • Reads 30,539
  • Votes 1,295
  • Parts 6
  • Time 51m
FarahOomerbhoy
Complete, First published Jan 21, 2017
academycentaursfaefantasyfantasyworldfriendshiphighfantasykingmagemagicnobilitypegasusprinceprincessroyalroyalbloodroyaltyschool
⭐️Silver award winner in IBPA's Benjamin Franklin Awards 2018, Finalist in the 2018 EPIC eBook Awards, Notable Indie in Self Unbound's 2018 Best Indie Book, Silver Medal winner in the 2017 Moonbeam Children's Book Awards & Bronze Medal winner in the 2017 Readers' Favorite Book Award⭐️

Aurora Firedrake returns in the spellbinding sequel to The Last of the Firedrakes.

The seven kingdoms of Avalonia are crumbling and evil is spreading across the land like a plague. Queen Morgana is close to finding a way to open the Book of Abraxas and it's only a matter of time until she uses the power trapped inside its pages to enslave the entire world.

With Avalonia growing more dangerous by the day, Aurora must travel through war-torn lands and deep into the heart of the fae kingdom of Elfi. Her goal is to find a legendary weapon infused with the last of the realm's ancient magic-the only weapon in the world powerful enough to stop the queen.

Aurora might have survived her first battle against Morgana, but the true fight to save her kingdom and restore her throne has only just begun...

You can now purchase The Rise of the Dawnstar in ebook, hardcover, paperback, and audiobook format at Amazon, Barnes and Noble, Apple, Kobo, and more.
All Rights Reserved
academycentaursfaefantasyfantasyworldfriendshiphighfantasykingmagemagicnobilitypegasusprinceprincessroyalroyalbloodroyaltyschool
Table of contents

6 parts

Sign up to add The Rise of the Dawnstar (The Avalonia Chronicles #2) to your library and receive updates
or
#356fae
Content Guidelines
You may also like
The Shadow Crawler by Clog-bot
18 parts Ongoing
Unable to stop the Fourth Realm from invading her home, Rowan must go to war. Using her dream-walking abilities to take over the bodies of enemy soldiers, Rowan fights on the front lines, giving everything she has to keep her realm safe. Season 2 of The Skin Thief *** Two worlds slowly collide, and an unexpected enemy rises. War has arrived in the Second Realm, threatening to destroy Rowan's home. With her Dream-Walking abilities, Rowan is ordered to fight deep in enemy-occupied territory, taking over the bodies of enemy soldiers in deadly battles. To make matters worse, Marcus, the man she betrayed, survived her killing blow and he is hunting her down, dead set on revenge. In the Fifth Realm, the timid, naive priestess is gone. Kiora has risen from her slumber and hatched her dragon, Beira. With a dragon by her side, Kiora wields power and new alliances are made, especially when a new wife joins the harem - a fierce woman of fire who warms Kiora's cold, broken heart. Despite her newfound power, Kiora and Beira are not invulnerable. Schemes threaten to destroy her and her beloved dragon, but this time, Kiora will not take it lightly. She will have her revenge against those who wronged her. She will be their empress. Even if she has to bury this realm in ice to do it. *** Weekly updates on Mondays. Wait & read for free, or unlock with coins-the choice is yours!
Queens & Liars-Sequel to Three Broken Kingdoms (Completed) by Gemejoe
75 parts Complete
'She was a blade, forged in the flames that had burned her kingdom.' Book 2 of the Lost Continent Asriel and Miras have fallen. Their legendary armies are gone, their cities burnt to their ground, their people enslaved or murdered. The Empress now rules the whole of the Lost Continent, and none seem able to challenge her reign of shadow... In Dorgon, the legendary general of Miras is chained alongside the long-prophesied Elfin Queen. The Dragon descends into darkness and vengeance and Layla Elenith slowly turns to madness to shield her from despair. They are the sole hopes of their countries....and their only chance of escape lies with a scheming princess and two spies that will do anything to save them. Jasper Merson and Talia Swallow have sacrificed everything for a chance to free the ones they love. Their pasts haunt them, but they are far from helpless. With a traitorous heir watching their backs, can they raise an army to save the Lost Continent and free the Dragon and the Elfin Queen? Lysandra Crimson framed her older brothers for treason and took Markus' place as Heir to the Kallian Empire. Yet her job is not half-done. Once she planned for every variable. Now she is entangled with the rebellion and acting desperately in order to secure the throne she has schemed her whole life for. With her brother still loyal to the Empress and her best friend heading in the thick of battle against him and his family, can she save both and take the crown? Or has she finally gotten in too deep? Despite all her efforts, her people are not yet free. Nala's fight against the Empress continues; despite everything, she refuses to give up. With the Keeper Queen, the Lady of Veron and Celeste and Rose Lisell at her side, can she defeat Medea at last? Or will the Lost Continent fall forever into shadow? Duty. Darkness. Destiny. Deception. And above all, vengeance...
Royal Games by csutcliffebooks
60 parts Complete
After a failed assassination attempt, a princess leaves her life in a magical world to live a normal life among humans, but leaving royal life behind isn't as simple as she had hoped. Upheaval in the royal family follows closely behind her. Princess Alyssa doesn't like living in Opa Palace in the magical world of Topia. She hates the politics and façades surrounding her, so she plans to renounce her royal title and go to a regular university on Earth. Everything is set up, ready for her to live the life she always wanted. However, a traitor in the palace doesn't want her to leave... Or live. Alyssa flees to Earth after a failed assassination attempt. Under an alias, she manages to go to university. She has the life she wanted, but cannot shake the shadow of her royal life. With the help of friends both new and old, she must unravel a plot far greater than she could've ever imagined. This story mixes the medieval aspects of fantasy with modern day life. Magic, romance and secrets can be found within. Awards: 1st in Young Adult for the Books and Beyond Awards 2021 2nd in Fiction for the Amazing Book Awards 2nd in Paranormal for the Golden Writer Award Top Rankings: #9 in Hiddenidentity (11/05/21)
A Clash Of Light And Thunder (War Of The Forgotten Lovers Book 1) by AzulMidnight
43 parts Complete Mature
Featured in Wattpad HighFantasy & Magic II 19-year-old Aria is ready to accept her doomed fate of marrying the cruel Lord Lathik. An alliance that will secure a large army for her hateful brother's war against the fae. When destiny intervenes and her carriage gets attacked by bandits, she falls into fae territory. Pulled from the grasp of death and captured by the handsome crown prince, she can only pray he will never find out she is the enemy kingdom's princess. The fae prince, Elvin, is haunted by his mother's final words of a great war to come, of lies told, and a girl with redwood hair at the center of it all. When he saves a human that fits that description with rare light magic powers, he must decipher if she will be a friend or a foe. Is there something more to the lingering pull they feel towards each other? Will years of hate between humans and fae win out? How are their fates intertwined by the past? -----.------- "Do you know what you are asking?" Elvin's baritone voice vibrated down Aria's back. His velvet tone trickled down her skin like a gentle touch. "Yes... I want to know. What it feels like to be held with care." Aria truly did want to know... this may be the only chance she would get. ------.------ War Of The Forgotten Lovers Book 1 Best Rankings: #1 out of 6.5k in Fae 09/07/21 #1 out of 14.3k in Elf 10/02/21 #1 out of 18.7 in FantasyAdventure 10/01/21 #8 out of 87.9K in YoungAdult 09/13/21 EDITING
Secret of the Snow Queen (Fire and Ice Book #1) by Galilea_Galaxia
60 parts Ongoing Mature
In a land where power and deception reign supreme, two unlikely heroes find their fates intertwined in a battle against a malevolent force. Kelvin, a daring thief, gets caught in a perilous mission to steal a prized horse, only to discover that his father, the commander of the army, holds his fate. Faced with a choice between execution or joining a rebellion, Kelvin is thrust into a world of warfare and treachery. As he navigates the dangers of battle and espionage, Kelvin's path crosses with powerful figures and long-buried secrets, forcing him to confront his past and his true allegiance. Aurora, pregnant and desperate, flees from her abusive captor, only to fall into the hands of her sinister former guardian, Morgana. Trapped in Morgana's lair, Aurora's resilience is tested as she battles her tormentor's dark magic and her own fears. Her escape hinges on the unlikely help of Vladimir, a guard with a mysterious allegiance. As Aurora's journey unfolds, she uncovers hidden truths about her lineage and the dangerous legacy of the Snow Queen. Their separate paths converge in a tumultuous struggle against the forces of darkness. With the looming threat of the Snow Queen and the rebellion's fight for freedom, Kelvin and Aurora must navigate a web of alliances and betrayals. Will they uncover the secrets that bind their destinies and overcome the shadows that threaten their world? Secret of the Snow Queen is an epic tale of courage, magic, and the unyielding fight for freedom. Dive into a world where every choice carries immense stakes, and where the true strength of the heart is tested against the chilling forces of evil.
The Bane of the Empire by AnnyVirdi
41 parts Complete
The world is ruled by a tyrant King. The Old King was killed and with him the magic that coursed through the world was sealed away. Dawn Rentradie, a human girl, is sent to Eastmaw to collect a tome that triggers a sequence of events that places her in the path of a Fae warrior named Hunter. Follow Dawn, as she uncovers the secrets of a world just out of reach but all around her. Turns out magic wasn't just a children's story. Genre: Young adult, High Fantasy, Adventure, Romance, Fae Folklore
Lost (Part 9 of the Ignaius-Saga) by Dreighton
17 parts Ongoing Mature
What is a king without allies and armies? What is a god without power? Tanier and Variel will have to find out when they are facing the most deadly threat Aurora has to offer to them. This is part 9 of the Ignaius-Saga. The Ignaius-Saga: The King's New Toy (https://www.wattpad.com/story/289195105-the-king%27s-new-toy-part-1-of-the-ignaius-saga) The Birth of Ignaius (https://www.wattpad.com/story/294970097-the-birth-of-ignaius-part-2-of-the-ignaius-saga) Homecoming (https://www.wattpad.com/story/295175848-homecoming-part-3-of-the-ignaius-saga) The Siege (https://www.wattpad.com/story/295587092-the-siege-part-4-of-the-ignaius-saga) Forged in Fire (https://www.wattpad.com/story/312220343-forged-in-fire-part-5-of-the-ignaius-saga) Shades (https://www.wattpad.com/story/325097295-shades-part-6-of-the-ignaius-saga) New Horizons (https://www.wattpad.com/story/338203498-new-horizons-part-7-of-the-ignaius-saga) Dawn of the Unconquered Sun (https://www.wattpad.com/story/350011924-dawn-of-the-unconquered-sun-part-8-of-the-ignaius) *** Created from an RP over email that got edited slightly for more convenient reading. Story is finished, but I will polish each chapter a little as I post.
The Last of the Firedrakes [Watty Award Winner 2015] by FarahOomerbhoy
45 parts Complete
⭐️Silver Medal winner in the 2016 Readers' Favorite Book Award, Silver award winner in IBPA's 2016 Benjamin Franklin Awards, Semifinalist Winner in the 2016 Kindle Book Award, Finalist in the 2015 USA Best Book Awards, Winner in Wattpad's 2015 Watty Awards, Awesome Indies Approved & A Wattpad Featured Story⭐️ She never felt like she belonged...until magic pulled her into a world beyond her wildest imagination. Perfect for fans of the Throne of Glass series and the Grisha Trilogy. Sixteen-year-old Aurora wishes she were anyone else. Mistreated by her adopted family and bullied at school, she believes things can't get any worse. But when she's kidnapped and dragged through an ancient tapestry into the magical world of Avalonia, she soon discovers that some dreams can easily turn into nightmares. Hunted by the evil tyrant Queen Morgana, who will stop at nothing to get rid of the last surviving heir to the powerful Firedrake dynasty, Aurora struggles to fit into her new life as a mage at the prestigious Academy of Evolon. Threatened by treachery at every turn and desperate to prove herself worthy, she uncovers a dark, complicated web of political intrigue that threatens the very existence of the seven kingdoms of Avalonia. Aided by the powerful Duke of Silverthorne, a fae friend, and a handsome but mysterious outlaw called the Black Wolf, Aurora struggles to master her magic and get her rare powers under control before it's too late. If she fails, her new home and her family will be enslaved forever... The Last of the Firedrakes is the first novel in The Avalonia Chronicles series of enchanting YA fantasies. If you like resilient heroines, plentiful magic, immortal fae warriors, and sizzling romance you'll love Farah Oomerbhoy's enthralling story. You can now purchase The Last of The Firedrakes in ebook, hardcover, paperback, and audiobook format at Amazon, Barnes and Noble, Apple, Kobo, and more.
Girl of Flower and Flame by TAJoseph
16 parts Ongoing
Stolen as a gift for the faerie prince, Eulalia's only hope of returning home is to become a spy for the rebel army and learn the prince's plans for war, but the more she's with him her contempt wilts, putting herself and many others in danger. *** After being stolen as a gift for the faerie prince, Eulalia gets embroiled in a brewing civil war when she befriends the handmaidens who are secretly a part of the rebel army. Convinced that befriending the prince will help their cause and get her home, Eulalia goes undercover as a spy. But as tensions between the high born and low born faes rise, Eulalia becomes tangled in between, discovering that the prince isn't quite the person she thought, and her new friends haven't been entirely honest. Copyright © 2024 T.A. Joseph All rights reserved
The Realms [Watty 2017 Shortlist] by RElizabethM
45 parts Complete
One mistake changes Hannah's life forever, exiling her from her realm and isolating her from the man who loves her. Now, Hannah must find a way to restore Ryan's memories and get them both back home before she loses everything forever. After threatening Ryan's father, the Ruler of the Realms, Hannah is transplanted into a new life in the Second Realm. Unable to get through to Ryan or to find her way back to her birth realm, Hannah enlists the help of Maizie, another banished soul who has some secrets of her own. Hannah knows that Ryan's father is abusing his power on the Third Realm and she intends to stop him, no matter the cost. Seeking out the Keepers of the Realms, Hannah and Maizie are drawn into a web of deception that leaves Hannah struggling to find the right path for herself and Ryan. Hannah's choices could save Ryan and the Third Realm but may leave her facing an uncertain future. What have people been saying about The Realms? *This book is awesome. I wish I could erase my memory of it and start it all over again - alubenlanretni *I loved this book - a3griffin32 *This is so amazing. You are truly talented - collettekozuchlepley *Love love loved this book! - shantelle721 *Loved the book! I was anxious to see what was coming next and was not disappointed when it did! - nicoleblakebontaine #5 in Adventure - January 26th, 2017 Third Place - 2016 Undiscovered Writers Awards in Adventure Featured story December 2016 - July 2017. Watty Awards Shortlist 2017 Cover by @pipo_here_
You may also like
Slide 1 of 10
The Shadow Crawler cover
Queens & Liars-Sequel to Three Broken Kingdoms (Completed) cover
Royal Games cover
A Clash Of Light And Thunder (War Of The Forgotten Lovers Book 1) cover
Secret of the Snow Queen (Fire and Ice Book #1) cover
The Bane of the Empire cover
Lost (Part 9 of the Ignaius-Saga) cover
The Last of the Firedrakes [Watty Award Winner 2015] cover
Girl of Flower and Flame cover
The Realms [Watty 2017 Shortlist] cover

The Shadow Crawler

18 parts Ongoing

Unable to stop the Fourth Realm from invading her home, Rowan must go to war. Using her dream-walking abilities to take over the bodies of enemy soldiers, Rowan fights on the front lines, giving everything she has to keep her realm safe. Season 2 of The Skin Thief *** Two worlds slowly collide, and an unexpected enemy rises. War has arrived in the Second Realm, threatening to destroy Rowan's home. With her Dream-Walking abilities, Rowan is ordered to fight deep in enemy-occupied territory, taking over the bodies of enemy soldiers in deadly battles. To make matters worse, Marcus, the man she betrayed, survived her killing blow and he is hunting her down, dead set on revenge. In the Fifth Realm, the timid, naive priestess is gone. Kiora has risen from her slumber and hatched her dragon, Beira. With a dragon by her side, Kiora wields power and new alliances are made, especially when a new wife joins the harem - a fierce woman of fire who warms Kiora's cold, broken heart. Despite her newfound power, Kiora and Beira are not invulnerable. Schemes threaten to destroy her and her beloved dragon, but this time, Kiora will not take it lightly. She will have her revenge against those who wronged her. She will be their empress. Even if she has to bury this realm in ice to do it. *** Weekly updates on Mondays. Wait & read for free, or unlock with coins-the choice is yours!

More details