The Day We Went to the Moon
whoopsydaisy7
  • Reads 5
  • Votes 0
  • Parts 1
  • Time <5 mins
  • Reads 5
  • Votes 0
  • Parts 1
  • Time <5 mins
whoopsydaisy7
Ongoing, First published Jan 24, 2017
argoelfinepicfantasylightmagicmagicwarmoonmorganlefaymorganlefayenecromancersnoradidaronsecretsstory
We needed a place to go, somewhere to escape.  People on Earth everywhere were becoming more and more aware of our kind.  Our most accomplished and clever necromancers were researching ways to prevent a major global conflict between magical beings and earthly humans.  People like Neharia Pronn, Nora D. Idaron, and even Morgan LeFay of Lancelot were on our side, so there was little chance of failure. . . however even our greatest minds were struggling with ideas until a genius named Evianne had a eureka moment: magic belongs under the surface of the moon!
All Rights Reserved
argoelfinepicfantasylightmagicmagicwarmoonmorganlefaymorganlefayenecromancersnoradidaronsecretsstory
Table of contents

1 part

Sign up to add The Day We Went to the Moon to your library and receive updates
or
#2elfin
Content Guidelines
You may also like
Flower and Tree by SharonRose327
5 parts Complete
"Why did you do this to us? Why take dying and dead minds and force them on unwilling and unknowing random people?" Her voice did not raise, but the few physical items in the room began to shake, and the air to on a distinct smell of sulphur. "Why not just let us live normal lives? Why burden us with this?" Eventually It spoke. "I will tell you what I told those you host. Only Heaven, Hell, and their respective rulers are eternal, and even the Master of Lies and his domain shall yet fall under the sword of the One that the Druids called the White God." Rated T for the beginning of Chapter 3 See last chapter for information on my lack of updates. Also, this is one of earliest stories that I have written(discounting the ones that I wrote when I was about four), but I only re-found it recently. To those who have read it before it got 'revamped', it was once called 'Rosella Tiger'.
Just The Beginning (Prince Merlin Fanfic) by I_Always_Need_Magic
21 parts Complete
IN A LAND OF MYTH AND A TIME OF MAGIC THE DESTINY OF A GREAT KINGDOM RESTS ON THE SHOULDERS OF A YOUNG MAN HIS NAME...MERLIN. And he's going to have another adventure that includes Morgana, potions and this time Merlin discovers his true past, having a surprising encounter with someone very dear to him. This is a prince merlin fanfic. It is not Merthur if you want to read Merthur it's not here sorry. I'm really bad at writing a summary but the book is much better. Merlin does not belong to me : ( Around 17,200 words.
Merlin: The Secret by MysteryOfWordsDK
16 parts Complete
This is a Fan-Fiction based upon the BBC series 'Merlin': Merlin is busy as usual working as King Arthur's servant. He rarely gets a good night's sleep, and it's beginning to take its toll on him. The king begins to notice. Love is growing between Arthur and Gwen, which is a joy to some, but a curse to others. Morgana goes all in to prevent Gwen from taking her place as queen beside Arthur on the throne of Camelot. She is prepared to do anything to win and is now more determined than ever to discover who Emrys truly is. Will Merlin be able to keep up appearences and at the same time fulfill his destiny? Will he have enough strength to defeat Morgana? And perhaps most importantly; will Arthur finally learn the truth? It becomes clear to Merlin that he must guard his secret with even greater care - or it might no longer hold. One thing is for sure; everyone is in for a surprise as the story unfolds... (Continued in my other story "Merlin; The Land Of Albion") :D
It's not Betrayal by twixlea
11 parts Complete
"Merlin has-" The ghost of Uther Pendragon has told Arthur that Merlin has magic. Arthur struggles to deal with it, until he's forced to once Camelot has a familiar new visitor. ~ Morgana crooned to the guard, her words cold but soothing, smile apparent in her voice. The sharp clicks of boots snapped against the cold dungeon air as a high-headed, cold-hearted sorceress stood proudly in front of the old man. Dark hair, wild like a bloodthirsty animal, contrasted sharply against her pale, creamy skin. A dangerous smile lingered on her lips, watery green eyes gleaming with malice as she tilted her head to survey her prisoner with mock sympathy. ~ Heads up, this fic is as straight as a ruler, so don't be expecting gay smut. I warned you!
Turning Back Time (Merlin) by Dollophead111
21 parts Complete
Merlin and Gwaine decide to pull a prank on Arthur, which turns out bad for Merlin. Arthur decides to punish Merlin by going on a hunting trip. What will happen when they come across a sorcerer who turns Merlin back into a child? Will a certain secret be revealed? ~Light cursing in some chapters~ *I do not own Merlin, all rights go to BBC*
It's A Birthday Thing by AlimaBabes
14 parts Complete
A group of (brave) friends stand before the Dark Forest to get to Morgan's 16th birthday party. The only issue is the orge guarding the forest. And there goes all that brave flying out the window. ************************* (Comming Soon) Things are crazy on the planet of Delac. During an uprising, four friends scramble to get their butts off the planet before it's destroyed. All on Morgan's 18th birthday. (Birthday tribute)
The Guardians: Seekers of Artifacts and Keepers of the Keys by SilentNovels
13 parts Ongoing Mature
In the beginning, there was Nothing. Not even Darkness, just Emptiness. Then Life shone bright. Magic appeared and brought the universe with it. Creatures of Magic came to be. There was one creature that did not come from magic-the Human. As Humans evolved they discovered Magic. Humans who were able to use Magic became known as Magicians. The Humans would create objects that would collect Magic and become Artifacts. These artifacts have the power to wreak havoc on the entire universe if in the wrong hands. A group of Magicians banded together to collect these Artifacts and store them. Whenever the universe was in danger, a new team would form to become powerful Magicians and save the world. They are... The Guardians.
Boy From The Woods by IgnatiousTheWarlock
20 parts Complete
Arthur Pendragon has always trusted his father's opinion of sorcery. He has witnessed, first hand, the atrocities Camelot's enemies could commit with the aid of magic. However, after Arthur, Morgana, and Gwen give shelter to a strange boy, Merlin, they find wandering the woods, Arthur begins to question all he knows. Will Arthur be able to protect Merlin from his dark past? What if Merlin wasn't raised by Hunith or even Gaius, but by a corrupt king intent on taking advantage of Merlin's power? **merthurish** (Also on AO3)
A Different Destiny / Merthur by Kat_Winters
27 parts Complete
A Merthur fic set in canon era. After two years of putting up with his useless excuse for a manservant, Arthur begins to suspect that there may be more to Merlin than meets the eye. But Merlin's not the only one with a secret. And maybe destinies aren't always as they seem. AU where I use elements of all five seasons in a way that does not always comply with canon. WARNING: Contains: (some) violence, mentions of blood, and a lot of gayness (duh)
Dark Merlin: The Man Called Emrys by Camelot101
21 parts Complete
What would you do if you were trapped inside your mind? That every time you slept, the beast came out to terrorize the people you loved. After escaping Morgana's never ending torture, a series of killings breaks out in Camelot. At first, the only victims are servants, but Uther's fear leads him to believe the attacks are magical and will soon result in the death of his son. Trying to hide his trauma, Merlin will stop at nothing to ensure the safety of Camelot, but as the killing continues, he will soon learn that he is behind them only he has no memory of ever attacking. Going by the name Emrys, Merlin's double half has teamed up with his lover Morgana, and as a war brews between the sorcerers and the Pendragon's, Emrys is working as an inside man under Merlin's cover, killing off anyone who stands in his way. As he fulfills his role with Morgana in seeking Camelot's destruction, his destiny edges closer, and the prophecy of him being Prince Arthur's bane is nigh. After the death of Uther and his son, Emrys and Morgana will be able to claim the throne for themselves and welcome in a new era. One where magic is welcomed. After discovering he has a dark half, Merlin sets out to find a way to stop the upcoming war and free himself from his inner monster, but the way doesn't seem easy. With the help of a letter from his father, he must learn to overcome Emrys before Emrys takes full control. Disclaimer: I do not own anything from Merlin ----------------- #1 in DarkMerlin in June of 2023
You may also like
Slide 1 of 10
Flower and Tree cover
Just The Beginning (Prince Merlin Fanfic) cover
Merlin: The Secret cover
It's not Betrayal cover
Turning Back Time (Merlin) cover
It's A Birthday Thing cover
The Guardians: Seekers of Artifacts and Keepers of the Keys cover
Boy From The Woods cover
A Different Destiny / Merthur cover
Dark Merlin: The Man Called Emrys cover

Flower and Tree

5 parts Complete

"Why did you do this to us? Why take dying and dead minds and force them on unwilling and unknowing random people?" Her voice did not raise, but the few physical items in the room began to shake, and the air to on a distinct smell of sulphur. "Why not just let us live normal lives? Why burden us with this?" Eventually It spoke. "I will tell you what I told those you host. Only Heaven, Hell, and their respective rulers are eternal, and even the Master of Lies and his domain shall yet fall under the sword of the One that the Druids called the White God." Rated T for the beginning of Chapter 3 See last chapter for information on my lack of updates. Also, this is one of earliest stories that I have written(discounting the ones that I wrote when I was about four), but I only re-found it recently. To those who have read it before it got 'revamped', it was once called 'Rosella Tiger'.

More details