Love Bites (Crescent City Werewolves: The Short Stories)
JulieMidnight
  • Reads 42,507
  • Votes 2,147
  • Parts 14
  • Time 3h 56m
  • Reads 42,507
  • Votes 2,147
  • Parts 14
  • Time 3h 56m
JulieMidnight
Complete, First published Jan 25, 2017
adultalphaalphafemalealphakingalphaqueendarkfantasyfantasykinglovematurepackparanormalparanormalromancequeenrelationshipromanceshortshortstoryurbanfantasywerewolfweekwerewolves
A collection of stories all connected by one thing: Crescent City, the domain of werewolves. Slip through the streets of this city of magic and luxury, and you'll see alpha-kings with scars beneath their suits and blood staining the diamonds worn by their queens. Humans may be found there, too, scraping out a life in the spaces between pack territories. Fragile in the face of fangs. Entranced under predatory gazes.

Loyalty unbroken even in death, forbidden love that flares into murder, and dark passions that come to life only in the deep of night.  Welcome to a city that uncovers the beasts hiding in all hearts.
All Rights Reserved
adultalphaalphafemalealphakingalphaqueendarkfantasyfantasykinglovematurepackparanormalparanormalromancequeenrelationshipromanceshortshortstoryurbanfantasywerewolfweekwerewolves
Table of contents

14 parts

Sign up to add Love Bites (Crescent City Werewolves: The Short Stories) to your library and receive updates
or
#675short
Content Guidelines
You may also like
The Alpha's Queen by heater0387
29 parts Ongoing Mature
Devany Sterling spent her entire childhood moving between one foster family and the next. As an adult, she follows the few clues she has about her parents, but it isn't long before she runs into a dead end. Stuck bartending in the small mountain town of Silver City, she starts to wonder if it's time she lets go of the past and starts living in the present, but then Beckett Warner wanders into her bar. Alpha Marked at birth, Beckett always knew he was meant to lead, but his dreams of changing the outdated laws and traditions of the Wolf Packs are constantly met with resistance by those who are afraid change will take away their power. But when the magnetic pull of fate brings Devany into his world, his priorities shift. United by an unforeseen bond, they unearth a shared destiny that could shatter the foundations of their existence. Amidst a brewing storm of deception and treachery, they discover a profound truth: their fates have always been tied together, and those in power will do everything to keep them apart. *this story contains mature themes
Pure Paws by JocelynSmock
39 parts Complete Mature
Tsk-tsk. Alex Hayes lets her anger get the best of her one horrible day. An abusive father takes role in beating his child senseless everyday for two years straight. Alex's true beast takes over and saves her life. This gives her hope of a long journey that lays ahead. Christopher Black is an alpha of an extremely small yet powerful pack, the 'Crescent Moon' pack. A not yet found Luna will take action in her command and fall for her mate. They live happily for a while before things take turn for the worst. A certain powerful one must step up and fulfill a long told prophecy which will save Were kind. There is only one issue standing in the way of this. Now, revenge will be replaced. Love will lose it's fall. Fatal mistakes will be made. Read on to find out the answers to more questions. But, may I ask you this one question? Are you ready to be sucked up into the world of terror and the great story of untold love and power? **Copyright of JocelynSmock**
4. 1 | Liberty ✔️ by littletroublemaker_
51 parts Complete
Liberty knew from the moment she was betrothed to Prince Aziel that she would never be happy. She vowed she would stop at nothing to keep herself away from him. When a mysterious portal opens up, she takes a chance and hops through it. After all, this was her chance at freedom? What she didn't expect was to find herself on a werewolf pack's territory. Alpha Gabriel was always lucky. He still hadn't found his mate - the woman who he was destined to be with. Just as he was about to accept that he would never meet her, he gets an alert that his territory has been breached. When these two meet, sparks fly, along with fists. They are both stubborn and competitive. Giving in to their feelings will not be easy. But who said love was easy?
Her Tyrant Alpha [EXCERPT] by ESHurricane
6 parts Complete Mature
*Available in full on Radish or Patreon!* She was born in fire. He was forged in ice. The clash will scorch them both. After a disease wipes out all human life on earth, the world is left to the werewolves. As packs organize and claim territory, an opportunity arises to collect information from a Viking pack headed by the dangerous alpha, Nolan Frosaker. Ashelin jumps at the chance to go undercover, but only partly because she wants to contribute to the mission. The Viking King intrigues her, and she has unique talents that will get her close to him. What she doesn't anticipate is Nolan's own unique talents, and how quickly she desires to be completely at his mercy. Warnings: This story is rated mature for a reason. Rated NC-17 for very intense bdsm power play in an environment that wouldn't be safe if it were humans not in fiction. NOTE: This story takes place in the Bloodlines universe, but can be read as a standalone. If you're curious about the apocalypse and want more of Ashelin and her previous pack, check out Bloodlines Vol. 1 for the first entry in that series and info on reading the rest!
The Alpha of Alphas by as_idle_as_it_gets
28 parts Ongoing Mature
If the man in front of me is my fated one, then I shall be damned than let him find me for who I am. For I am his as much as he is mine. But I am made from darkness and he from light. Unfair. That is what this mate bond is. And so I run like the dead are after me. Because they are. • In a world where rogues, whether born one or made into one, are killed or imprisoned without question, Leona Austel is an ex-rogue who had the luck of being saved from the clutches of endless bloodbaths when she is adopted by a respected Alpha. Her life has been a constant fear of being found out ever since. But her life crumples even more so when she finds her mate to be the King of Werewolves, the alpha of alphas, a cold ruler known for his contempt for rogues. Their fate is a cruel one. He can't know, or she will have to kill him. She can't be found, or he will have to kill her.
Alpha descent: A Human's rise to power (BxB) by Kyrielle_woods_027
19 parts Ongoing Mature
(BxB) Wolf's blood, human body & Alpha soul. A Maelstrom merge that was left to be dealt by one person alone. Alexander Wolf, the born-human descendant of the greatest pack of his world, is the sole heir of the Alpha of the prestigious Prime Crescent Pack. His birth has always been a calamity, a distress. Every breath he takes reminds him of the misfortune he's caused to his parents, family, and pack. Although welcomed, he doubts their sincerity, as he lacks a wolf and the ability to shift like other werewolves. He's spent his life alone, hiding behind high walls and large doors whenever his parents tried to introduce him to the pack. But now, with his coming of age, he must step forward into alpha duties and serve his pack. Will he find himself ruling with grace, or will he run away like he always has? Will he give up his birthright due to the Moon Goddess's cruel twist of fate? As a human in a wolf pack, his life is far from fortunate, unlike his human mother, the Luna, who is protected by the powerful Alpha, his father. However, he can't escape the whispers within the pack: "Can a human really be our next Alpha? No way!" His life is already a mess, and the Awakening Ceremony, a significant milestone, has shaken him to his core. He doubts his ability to fulfill alpha duties and find a mate bond, especially without a wolf of his own. Will he find someone to accept him without being looked down upon? Can he satisfy his primal urges without being a werewolf himself? But he doubts whether he'll have a mate at all. Cover by @CuteFairyDust Started: 28/06/2024
Secrets in the Moon (Crescent City Werewolves #1) by JulieMidnight
36 parts Complete
Savage appetites and opulent vices are a way of life in Crescent City, a metropolis split among werewolves and humans. As one of its most beautiful socialites, Cora Marshall thrives on scandals and the attention they bring. Yet even she is stunned by her father's murder... and by becoming the prime suspect for it. Determined to prove her innocence, Cora hires Detective Sam Hayes, an irresistibly handsome werewolf with as many secrets to his name as she has to hers. To uncover the truth, they must trust each other with everything--especially now that the real killer hunts them throughout the city. *A WINNER OF THE 2023 ALPHA AWARDS*
The Rise of Venus by cosmic_lattes
71 parts Complete Mature
|𝟐𝟑𝐱 𝐅𝐄𝐀𝐓𝐔𝐑𝐄𝐃 & 𝐖𝐀𝐓𝐓𝐘𝐒 𝟐𝟎𝟐𝟏 𝐒𝐇𝐎𝐑𝐓𝐋𝐈𝐒𝐓𝐄𝐑| This epic werewolf themed fantasy follows a no-nonsense future Luna, 𝐕𝐄𝐍𝐔𝐒 𝐁𝐑𝐈𝐆𝐇𝐓𝐃𝐎𝐎𝐌, as she embarks on a high stakes journey to save her people from extinction. Threatened with genocide and war from the cold-blooded dark witches, Venus finds herself cast in The Propehcy of Lost Hope alongside six other werewolves. Fate dictates that to prevent catastrophe the Seven Stars must complete the tasks set forth in the prophecy before the Winter Equinox. The catch? If they fail then Venus has to sacrifice her Mate to in order to preserve the continuity of her race. Caught in a web of love, lies, and secrets. Venus and her newfound friends must face not only the dangers of the past and present. But the demons that slumber deep within. As time passes and things get more complicated, it becomes clear why the prophecy states they can be the saviors that protect their people. Or the foes that lead to their destruction. 𝐒𝐭𝐚𝐭𝐮𝐬: 𝐂𝐨𝐦𝐩𝐥𝐞𝐭𝐞 𝐆𝐞𝐧𝐫𝐞: 𝐖𝐞𝐫𝐞𝐰𝐨𝐥𝐟, 𝐟𝐚𝐧𝐭𝐚𝐬𝐲, 𝐫𝐨𝐦𝐚𝐧𝐜𝐞, 𝐝𝐢𝐯𝐞𝐫𝐬𝐞 𝐥𝐢𝐭 𝐒𝐭𝐚𝐫𝐭𝐞𝐝: 𝟎𝟏/𝟏𝟎/𝟐𝟏 𝐅𝐢𝐧𝐢𝐬𝐡𝐞𝐝: 𝟎𝟕/𝟐𝟖/𝟐𝟏 𝐑𝐚𝐭𝐢𝐧𝐠: 𝟏𝟖+ 𝐟𝐨𝐫 𝐠𝐥𝐨𝐬𝐬𝐞𝐝 𝐨𝐯𝐞𝐫 𝐄𝐃, 𝐬𝐮𝐢𝐜𝐢𝐝𝐞, 𝐯𝐢𝐨𝐥𝐞𝐧𝐜𝐞, & 𝐬𝐦𝐮𝐭 𝐂𝐨𝐯𝐞𝐫: 𝐂𝐉 𝐃𝐞𝐬𝐢𝐠𝐧
The Secret Luna: Book 1 of The Gifted Daughters Of The Moon Goddess (COMPLETED) by ericasilverbane
41 parts Complete
I could feel all this surging pain coursing through my whole body. Bones breaking and reshaping. I wanted to scream but I couldn't. Im in the woods all by myself and I don't know what is happening to me. "What is happening to me!!!" And then I saw darkness. Marie is a 17 and a girl in high school. She has always had a normal typical life living with her adopted family since she was a baby found in a box with a necklace with three wolfs as the pendant. She has friends, good grades, a loving family, people love her and adore her. Marie has always had a hobby for art and going through the woods. But one day as she is taking another walk through the woods behind the Great Woods Lodge her family went to for the whole summer, she is hit with sudden pain all throughout her body. ___________________________________________ Ranked as #971 in werewolf category 5/7/18 Ranked as #135 in stories category 8/25/18
The Art Of Sneezing by Keep_Your_Eyes_Open
69 parts Complete
New version available on my profile titled 'Crescent' ___________________________________________ Riley 'Mouse' Rivers sneezes a lot. She's allergic to dogs, which isn't too bad. That is, until she moves to a small town in North East Texas. Suddenly, every person she's around seems to own a dog. Alpha Alexander Crescent has almost given up hope about finding his mate. That is, until his mate sneezes her way into the hearts of his pack. Suddenly, the most powerful alpha in the United States seems to be wrapped around the finger of one teenage girl. With a confusing past, Riley dives deeper into confusing situations in Texas. Can she survive as the Luna of the Crescent Moon pack, fighting rouges - all while trying to figure out how she can shift when there is no voice in her head? ____________________ This book is years old with younger characters. I'm working on a rewritten, edited version that can be found on my profile titled 'Crescent.' Read that one if you want more realistic themes, older characters, and better writing!
You may also like
Slide 1 of 10
The Alpha's Queen cover
Pure Paws cover
4. 1 | Liberty ✔️ cover
Her Tyrant Alpha [EXCERPT] cover
The Alpha of Alphas cover
Alpha descent: A Human's rise to power (BxB) cover
Secrets in the Moon (Crescent City Werewolves #1) cover
The Rise of Venus cover
The Secret Luna: Book 1 of The Gifted Daughters Of The Moon Goddess (COMPLETED) cover
The Art Of Sneezing cover

The Alpha's Queen

29 parts Ongoing Mature

Devany Sterling spent her entire childhood moving between one foster family and the next. As an adult, she follows the few clues she has about her parents, but it isn't long before she runs into a dead end. Stuck bartending in the small mountain town of Silver City, she starts to wonder if it's time she lets go of the past and starts living in the present, but then Beckett Warner wanders into her bar. Alpha Marked at birth, Beckett always knew he was meant to lead, but his dreams of changing the outdated laws and traditions of the Wolf Packs are constantly met with resistance by those who are afraid change will take away their power. But when the magnetic pull of fate brings Devany into his world, his priorities shift. United by an unforeseen bond, they unearth a shared destiny that could shatter the foundations of their existence. Amidst a brewing storm of deception and treachery, they discover a profound truth: their fates have always been tied together, and those in power will do everything to keep them apart. *this story contains mature themes

More details