Story cover for The Lost Azuralite (Sample) by JohnMichaelFarrar
The Lost Azuralite (Sample)
JohnMichaelFarrar
  • WpView
    MGA BUMASA 501
  • WpVote
    Mga Boto 67
  • WpPart
    Mga Parte 5
  • WpHistory
    Oras 24m
  • WpView
    MGA BUMASA 501
  • WpVote
    Mga Boto 67
  • WpPart
    Mga Parte 5
  • WpHistory
    Oras 24m
JohnMichaelFarrar
Kumpleto, Unang na-publish Feb 18, 2017
adventurearcanearchmagebluebowevilfantasyfiremagicflyingkivastoralostmemorymagemagicmananewworldraidstafftelepathywingswritingcommunity
**Unedited sample of published work**
The beginning of a hero's journey.

An evil that once destroyed the lands now lays dormant as an unlikely hero wakes from wounds made in a war that ended centuries ago...

Killian wakes in Forrayne Forest after being nursed to health. Can he unlock the magic inside in time to save the lands from complete destruction?

"Unique races, captivating narrative with dialogue that will take you on an emotional rollercoaster. If the lovable characters aren't enough to make you turn the page, the magic will." - C. Sheridan

"Definitely not one to read fantasy books but this one had me gripped from the start. This is a must read! Cannot wait for the next one!" - S. Hashmi

Want even more? Go to https://www.amazon.co.uk/dp/B07R9ZXQKX

For more information on the series go to www.landsofkivastora.com
All Rights Reserved
adventurearcanearchmagebluebowevilfantasyfiremagicflyingkivastoralostmemorymagemagicmananewworldraidstafftelepathywingswritingcommunity
Table of contents

5 parte

Sign up to add The Lost Azuralite (Sample) to your library and receive updates
o
#241arcane
Mga Alituntunin ng Nilalaman
Magugustuhan mo rin ang
The Potions Master and the Professor (SS x Oc) ni ilexmaii2103
62 parte Ongoing Mature
Severus Snape x Oc Severus Snape a miserable cold-hearted Potions Master and Sabrina Bowman, an elegant beautiful Professor. Follow the journey of Severus and Sabrina as they battle love, loss, heartbreak and death. Golden trio era. Follows the Movies 1-8. Is not accurate to the books. Professor Romance. Rated M for later chapters, there will be not be warnings at the start of chapters. This story will progress much like the Harry Potter films, they will get darker as they go along. Achievements ~ #1 potionsmaster (21/11/2024) ~ #1 Snaperomance (18/12/2024) ~ #1 hogwarts (26/12/2024) ~ #1 snapelove (03/01/2025) ~ #1 snapefanfic (08/02/2025) ~ #1 wizard (25/04/2025)
Apocalypse NEW VERSION ni SpartanCatlord
8 parte Ongoing Mature
Growing up in their sister's shadow wasn't easy; surviving after she left has been harder. In the nine years since their Kingdom was destroyed by the cruel Falcondar family, Kiridan has had two objectives: to stay hidden from the Falcondars, and to figure out why their sister never came back for them. They discover that she started an underground organization to overthrow the Falcondars...and then died three years ago while on a mission in the mountains. Determined to make something of their sister's efforts - and to be recognized as more than the less-talented sibling - Kiridan decides to break into the organization known as the Infernal Uprising, taking their rightful place among its leadership. But as the attack on the Falcondars draws nearer, they'll have to learn that leadership is more than barking orders, and that trust is difficult to earn. When the chaos spirals further than anyone expected, and new powers come into play from every direction, a lot of people may have to reevaluate what they stand for...whether they're an Infernal Uprising soldier, a traitor, or a Falcondar Princess herself. Sure, through the eyes of those in power, the world has always been in conflict. But for the next generation waiting to take over, the conflict is just beginning. And for the rest of the unsuspecting universe, it hasn't even begun. Which came first, the catastrophe or the change? And what's the difference in the first place? ******* ONGOING. Current word count: ~13,000 Genre(s): action / sci-fantasy *LGBTQ+* Cover: made by me
TUW 11: Tears in the Abyss ni Exequinne
21 parte Kumpleto
NELNIFA CORLEDIA IS SUPPOSED TO BE WEAK. During a brazen attack against her people, she is left with no choice but to take the lead. With knowledge coming from dubious places, a territory in shambles, and a people too scattered to fight back, she has to scout the enemy's base, mark her targets, and eliminate them before they cause more damage. Along the way, she discovers that the line between mercy and murder is thin enough to not exist. From the sprawling universe of 𝘛𝘩𝘦 𝘊𝘩𝘳𝘰𝘯𝘪𝘤𝘭𝘦𝘴 𝘰𝘧 𝘍𝘢𝘯𝘵𝘢𝘴𝘪𝘭𝘪𝘢, journey to hidden roads and forgotten paths in this brand new novella series set in the same universe and timeline as the main series. Be careful. There will be danger ahead. AN INSTALLMENT OF THE UNSEEN WARS NOVELLA SERIES ˜"°•.˜"°•˜"°•.˜"°•˜"°•.˜"°• © 2023 (First Edition) [20,000 - 25,000 words] WARNING: Make sure you read 𝘛𝘩𝘦 𝘊𝘩𝘳𝘰𝘯𝘪𝘤𝘭𝘦𝘴 𝘰𝘧 𝘍𝘢𝘯𝘵𝘢𝘴𝘪𝘭𝘪𝘢 Main Series first before continuing on to this story. The books can be found in a reading list in my profile, @Exequinne. [Cover by @Dayisdemigod]
Forsaken: The Chosen Trilogy - Book One ni RKSHobbs
30 parte Kumpleto Mature
Before you begin this story, I must warn you first. This is not a tale of dashing knights and lovely damsels awaiting rescue. It is not the tale of happy endings, with birdsong and rides into the sunset. It is a tale of light magic and dark, of dragons and monsters, of heroes and villains and the thin line between them. This is the tale of being broken, being made stronger, and then being broken again. This is a story of love of heartbreak so great if feels like your chest has been hollowed out and scraped clean, like you would never feel anything else ever again, and of love so powerful it can make even the gods tremble. This is not a happy story, but it is our story, and it is the only one I know how to tell. ********************** FORSAKEN is the first tale in the Saga of Darkness, following six brothers and sisters who have been named the Chosen of the Gods, destined to fight a great darkness that threatens their world. But evil wears many faces, and it will take the efforts of all- Kryssa, Brannyn, Lanya, Kylee, Alyxen, and Reyce- to survive the harrowing trials to come. ********************** FORSAKEN is a completed novel, being posted as a serial. Books Two through Five in the Saga of Darkness are also complete. Chapters posted every Monday and Friday.
Conquest: Rise Of The Arcane Warriors ni WhiteM3rc101
8 parte Ongoing Mature
In a world where ancient magic and cutting-edge technology collide, the realm of Eldoria stands on the brink of chaos. The legendary Arcane Warriors, once thought lost to the annals of history, are whispered to be returning, bringing with them the promise of unparalleled power. Arin Valtor, a humble blacksmith from the isolated village of Hearthglen, discovers he is the key to this ancient legacy when his home is razed by the ruthless warlord, Lord Varkas. In the ashes, Arin finds the Sigil of Enasalin, an artifact that awakens his latent connection to the Arcane Warriors. Driven by revenge and a burgeoning sense of destiny, Arin sets out on a perilous journey. Joined by an eclectic group of allies-Lysandra, a rogue mage seeking redemption; Garrick, a battle-scarred mercenary with a code of honor; and Eliona, a scholar of ancient lore-they traverse the treacherous landscapes of Eldoria, from the icy expanses of Korvath to the mystical forests of Sylvanis. Together, they must uncover the secrets of the Arcane Warriors, mastering arcane techniques while dodging the relentless pursuit of Varkas, who seeks to harness this power for his own dark ends. As Arin grows into his role, he faces trials that test not only his strength but his very soul. The path to becoming a true Arcane Warrior is fraught with both external battles against Varkas's army and internal struggles with the seductive nature of power. Will Arin rise to fulfill the prophecy of salvation, or will he succumb to the shadows of corruption? Conquest: Rise of the Arcane Warriors is an epic tale of magic, might, and the enduring quest for balance. It's a story of a young man's transformation from obscurity to legend, where the legacy of the past battles with the aspirations of the future, setting the stage for a new era in Eldoria. Dive into a world where every choice could tip the scales between light and darkness.
Guardians of the Light (Book 1: Rebirth) ni Kat_Penney
19 mga parte Kumpleto
Many centuries ago, an unspoken darkness swept across the land taking all that was light and pure in the world with it. Creatures of this darkness roamed free to spread the darkness wherever they went consuming any trace of light remaining. In order to stop The Darkness from controlling the world, a group of priests took the remaining pieces of light and placed them within the body of two chosen children. They became known as the Children of the Light. Their sacrifice was not in vain, leaving behind spoken words for the next generation of children born with the pure light energy within them. Over time an organisation built on these words was formed called The Guardians, who were tasked to seek out the next chosen children and protect them from The Darkness should it rise again. Centuries have come and gone as the battle between the light and the darkness still rages on, unaware of the human race that creatures live among them and that a battle between them and the guardians has gone on for many years. Present day we find ourselves in a small city named New Haeven that has become the centre of the secret world of light and dark.The current story follows a Guardian by the name of Ronin. Ronin saw the faces of the new Children of the Light and was tasked by the Elders to track them down and protect them at all costs.The children were both college students and were one male and one female whose names were James Hillman and Sara Danvers..When Ronin went to see he ran into a ghost from his past, Lillian. The story continues on with Ronin seeking answers from the Elders about how a Guardian could come back from the dead.
Revival: Of Cethore ✔ ni Spider-Hawk
41 parte Kumpleto
The dragon is sleeping; it's fading away. Only one can awaken it, only one can revive it. Will they make it in time? Cethore was once simply a land divided by the people within. Of the seven tribes, great power ran through their veins, each power unique to its tribe, but one tribe was blessed with power over all other tribes. They united the tribes to form the nation of Cethore, run by the Council of Sixeen. For many centuries, peace reigned, until the darkness crept into their hearts. Samari is a homeless orphan hoping to find a good life somewhere, a place where she belongs. Luck is not on her side as she runs into a street fight that is bigger than it seems. When she joins a guild that works for a dead king, she finds a version of herself she never knew existed--and friends she never had. But now she has to step up in order to keep the darkness at bay. With the fate of her world in the balance, she must decide between staying comfortable or fighting for greater power. [Fairy Tail meets Avatar: The Last Airbender] Warning! This book contains violence, bullying, racism, and dark scenes. | Completed | Book One in the Of Cethore series | Featuring a map made by @Ladune
COF 1: The Fairy Legacy ni Exequinne
67 parte Kumpleto
FIRST BOOK OF THE CHRONICLES OF FANTASILIA SERIES 𝘈𝘯 𝘢𝘨𝘦-𝘰𝘭𝘥 𝘳𝘪𝘷𝘢𝘭𝘳𝘺. 𝘈 𝘵𝘺𝘳𝘢𝘯𝘵 𝘲𝘶𝘦𝘦𝘯. 𝘈 𝘣𝘢𝘵𝘵𝘭𝘦 𝘵𝘩𝘢𝘵 𝘴𝘵𝘢𝘳𝘵𝘦𝘥 𝘵𝘩𝘦 𝘸𝘢𝘳. Xanthiene Vivenca's life drones on in a cycle of finding her next meal, ensuring the house won't collapse, and surviving until the next day. Then, a boy with cloud-white hair ruins it all by crashing through her roof, along with a set of problems tying her to the fate of the island. With the Human Queen terrorizing the kingdom, friends to save after falling victim to a wicked system, and a power she could barely understand, let alone control, Xanthy finds herself working with complete strangers to bring down a regime. Secrets unfold. Certain truths are revealed. A war beneath the island's surface finally bares its fangs. Now, Xanthy has to save her friends and herself before it's too late. ˜"°•.˜"°•˜"°•.˜"°•˜"°•.˜"°• © 2018 (First Edition) © 2021 (Second Edition) [90,000 - 95,000 words] [Cover by @Moxartx ; Text & Graphics by @Exequinne]
Solivagant ni dreams_of_silver
45 parte Kumpleto
Magic is to be feared. It is a wild, unpredictable thing, and anywhere it goes it brings mayhem and destruction. Those that wield it are even more dangerous. At least, that's what King Soren claimed when he hunted down and killed nearly every magic-user in Eldernia. The only ones he spared were sworn into Soren's service as elite agents that have one purpose, and one purpose only--find any remaining magic-users and give them a choice. Join the Valkir . . . or die. Asher, a sixteen-year-old boy, has managed to conceal his power for years. But when his secret is revealed, there will be no more hiding. || Winner of the 2020 Sinne Awards || || Third place in the 2020 Black and Gold Flames Awards - Fantasy || The fabulous cover is from @-designdistrict ! NOTE: This book is NOT public domain, whatever Wattpad says. All rights are reserved.
The Exiled King | ✔ ni Calagtic
117 parte Kumpleto
Fifty years ago, demons invaded the mortal realm of Dargon, leaving a trail of destruction across the five kingdoms. The six Guardians of that generation united the kingdoms and fought back against the demons, scattering their ashes to the winds. Then, they vanished into legend, and with them, their powers. When the lost powers awaken in six strangers across the mortal realm once again, they seek answers... What danger has compelled the powers to reappear after half a century of peace? There are rumours that another demon army gathers in the fiery realm of the Abyss, greater than the first and led by a cunning mastermind whose motivations are unknown. But something doesn't add up. The deeper they dig, the more twisted the truth becomes and the more uncertain their path forward. Who... or what must they truly save their world from? As destinies unravel and loyalties are tested, one question lingers: What if saving the world... means trusting the very force that could end it? An epic trilogy of gods, mortals, and fates intertwined-where it seems that things may have been set in motion long before anyone could ever have anticipated and the path forward may just be the one that ends in death. Trilogical Compilation | Books 1, 2 & 3 (If the number of chapters seems daunting, just know that most of the chapters are short) [Fans of The Stormlight Archive may enjoy this book] Best Rankings #7 in fantasyadventure (Out of 32.4k stories) #8 in journey (Out of 30.4k stories) Cover by Azanthiel Human written. No AI :)
Magugustuhan mo rin ang
Slide 1 of 10
The Potions Master and the Professor (SS x Oc) cover
Apocalypse NEW VERSION cover
TUW 11: Tears in the Abyss cover
Forsaken: The Chosen Trilogy - Book One cover
Conquest: Rise Of The Arcane Warriors cover
Guardians of the Light (Book 1: Rebirth) cover
Revival: Of Cethore ✔ cover
COF 1: The Fairy Legacy cover
Solivagant cover
The Exiled King | ✔ cover

The Potions Master and the Professor (SS x Oc)

62 parte Ongoing Mature

Severus Snape x Oc Severus Snape a miserable cold-hearted Potions Master and Sabrina Bowman, an elegant beautiful Professor. Follow the journey of Severus and Sabrina as they battle love, loss, heartbreak and death. Golden trio era. Follows the Movies 1-8. Is not accurate to the books. Professor Romance. Rated M for later chapters, there will be not be warnings at the start of chapters. This story will progress much like the Harry Potter films, they will get darker as they go along. Achievements ~ #1 potionsmaster (21/11/2024) ~ #1 Snaperomance (18/12/2024) ~ #1 hogwarts (26/12/2024) ~ #1 snapelove (03/01/2025) ~ #1 snapefanfic (08/02/2025) ~ #1 wizard (25/04/2025)

Karagdagang detalye